Project name: 36e434604258fe6

Chain sequence(s)	B: ESKLLSRHTLQVSAGGPLSSVTFVFNGDATLTVPLTLPAGATVLLRAESD
Selected Chain(s)	B
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:19)

• Minimal score value: -3.1908
• Maximal score value: 1.8529
• Average score: -0.5718
• Total score value: -28.5893

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	B	-3.0399
2	S	B	-2.9478
3	K	B	-2.8031
4	L	B	-1.6895
5	L	B	-0.6675
6	S	B	-1.6850
7	R	B	-2.5961
8	H	B	-1.8684
9	T	B	-0.6009
10	L	B	-0.3396
11	Q	B	-1.0608
12	V	B	0.0000
13	S	B	-0.7835
14	A	B	-0.6392
15	G	B	-0.6631
16	G	B	-0.5586
17	P	B	-0.4011
18	L	B	-0.0516
19	S	B	0.0174
20	S	B	0.3018
21	V	B	0.9078
22	T	B	1.1359
23	F	B	1.8529
24	V	B	1.8248
25	F	B	0.9427
26	N	B	-0.9770
27	G	B	-1.4200
28	D	B	-1.6713
29	A	B	-0.1949
30	T	B	0.8799
31	L	B	1.6548
32	T	B	1.2309
33	V	B	1.2798
34	P	B	0.5135
35	L	B	0.5584
36	T	B	0.1550
37	L	B	0.0000
38	P	B	-0.5795
39	A	B	-0.7161
40	G	B	-0.8759
41	A	B	-0.4007
42	T	B	-0.1127
43	V	B	0.5596
44	L	B	0.6962
45	L	B	-0.7843
46	R	B	-2.3126
47	A	B	-1.7531
48	E	B	-3.1313
49	S	B	-2.5848
50	D	B	-3.1908