Project name: 1361

Status: done

Started: 2026-03-25 17:13:16
Settings
Chain sequence(s) A: SALRQLLRELVFKWFKKIVLAAAPILGWSEEELQKITDEPVTAPEDEEYRKKLLEEAIKKMEELFEKGEFGKEYFENFLKALLLTLHFLVKDPAKLAAFLEAVRALVKGELSLEEFLEKLEEITGGVKFTFPEEWKKKVHAIFREIAKKL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:09:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:09:21)
Show buried residues

Minimal score value
-4.1087
Maximal score value
2.1077
Average score
-1.3876
Total score value
-208.1422

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S A -0.0980
2 A A 0.3690
3 L A 1.0083
4 R A -0.9526
5 Q A -0.8222
6 L A 0.9052
7 L A 0.0084
8 R A -1.4011
9 E A -1.1619
10 L A -0.2137
11 V A -0.2584
12 F A 0.0000
13 K A -1.8195
14 W A -0.8339
15 F A 0.0000
16 K A -1.4480
17 K A -1.7937
18 I A -0.3062
19 V A 0.0000
20 L A -0.4723
21 A A 0.0893
22 A A 0.5535
23 A A 0.0000
24 P A 0.6188
25 I A 2.1077
26 L A 1.0614
27 G A -0.0595
28 W A 0.0000
29 S A -2.0801
30 E A -3.4774
31 E A -3.8806
32 E A -3.4747
33 L A 0.0000
34 Q A -3.2038
35 K A -3.6183
36 I A -2.3591
37 T A 0.0000
38 D A -2.1928
39 E A -1.9474
40 P A 0.0000
41 V A -0.6123
42 T A -0.7652
43 A A -1.2197
44 P A -1.6240
45 E A -3.1072
46 D A -3.2208
47 E A -4.1087
48 E A -3.6501
49 Y A -2.4518
50 R A 0.0000
51 K A -3.2274
52 K A -3.4674
53 L A -2.4522
54 L A 0.0000
55 E A -3.7132
56 E A -3.9722
57 A A 0.0000
58 I A -2.6713
59 K A -3.8867
60 K A -3.4716
61 M A -2.6194
62 E A -3.6285
63 E A -4.0115
64 L A 0.0000
65 F A -2.1797
66 E A -3.4885
67 K A -3.2981
68 G A -2.1570
69 E A -1.8902
70 F A -0.3501
71 G A -1.0832
72 K A -2.1810
73 E A -2.0904
74 Y A -1.2057
75 F A -0.4278
76 E A -1.2505
77 N A -1.0193
78 F A 0.4452
79 L A 0.0000
80 K A -0.4064
81 A A -0.0926
82 L A 0.6517
83 L A 0.0000
84 L A 0.0000
85 T A 0.0000
86 L A 0.0799
87 H A 0.0000
88 F A 0.0000
89 L A 0.0000
90 V A 0.0000
91 K A -2.2455
92 D A -1.4275
93 P A -0.7593
94 A A -0.4983
95 K A -1.2918
96 L A -0.4825
97 A A -0.4967
98 A A -0.9221
99 F A -0.6940
100 L A -0.9170
101 E A -2.2763
102 A A 0.0000
103 V A 0.0000
104 R A -3.1074
105 A A -2.5097
106 L A 0.0000
107 V A -1.8655
108 K A -2.9381
109 G A -2.2528
110 E A -2.6612
111 L A -2.1044
112 S A -1.8384
113 L A -2.0206
114 E A -3.0086
115 E A -3.1226
116 F A 0.0000
117 L A -2.5105
118 E A -3.9745
119 K A -2.8349
120 L A 0.0000
121 E A -3.1882
122 E A -3.3246
123 I A 0.0000
124 T A 0.0000
125 G A -1.8790
126 G A -2.2078
127 V A 0.0000
128 K A -2.6226
129 F A -1.2651
130 T A -0.8530
131 F A -0.2701
132 P A -1.2941
133 E A -3.0937
134 E A -3.2539
135 W A -2.2516
136 K A -3.0074
137 K A -3.2628
138 K A -2.5221
139 V A 0.0000
140 H A -1.2817
141 A A -0.9242
142 I A -0.0759
143 F A -0.6876
144 R A -2.2310
145 E A -2.1783
146 I A -0.8113
147 A A -1.4828
148 K A -2.5785
149 K A -1.9166
150 L A 0.0604
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018