Project name: query_structure

Status: done

Started: 2026-03-17 00:36:03
Settings
Chain sequence(s) A: QVQLVESGGALVQPGGSLRLSCAASGMTGIFWRLRWYRQAPGKEREWVCGISQLPTPASYEDSVKGRFTCSRDDARNTVYLQLNSLKPEDTAVYYCAAANVLPGLPAELPIYWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:46)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:47)
Show buried residues

Minimal score value
-3.7287
Maximal score value
1.7479
Average score
-0.6675
Total score value
-82.098

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.3970
2 V A -0.7465
3 Q A -0.7874
4 L A 0.0000
5 V A 0.4647
6 E A 0.0000
7 S A -0.7009
8 G A -1.1377
9 G A -0.7198
10 A A 0.1522
11 L A 1.1674
12 V A 0.0741
13 Q A -1.2688
14 P A -1.4749
15 G A -1.2828
16 G A -0.8427
17 S A -1.2224
18 L A -0.9879
19 R A -2.2060
20 L A 0.0000
21 S A -0.5413
22 C A 0.0000
23 A A -0.3541
24 A A -0.1738
25 S A -0.8334
26 G A -0.9530
27 M A -0.0646
28 T A 0.1963
29 G A 0.3309
30 I A 0.8569
31 F A 0.0000
32 W A 0.5017
33 R A -0.7754
34 L A 0.0000
35 R A -0.4905
36 W A 0.0000
37 Y A -0.8729
38 R A -1.6264
39 Q A -2.3677
40 A A -2.2060
41 P A -1.6157
42 G A -1.9350
43 K A -3.4829
44 E A -3.7287
45 R A -3.0607
46 E A -2.9414
47 W A -1.1604
48 V A 0.0000
49 C A 0.0000
50 G A -0.4605
51 I A -0.2944
52 S A -0.1638
53 Q A -0.0127
54 L A 0.7231
55 P A 0.1789
56 T A 0.0560
57 P A -0.1629
58 A A -0.1176
59 S A -0.6857
60 Y A -1.1780
61 E A -2.1563
62 D A -2.7982
63 S A -1.8460
64 V A 0.0000
65 K A -2.8051
66 G A -1.8169
67 R A -1.3595
68 F A 0.0000
69 T A -0.9321
70 C A 0.0000
71 S A -0.7218
72 R A -1.6269
73 D A -2.4143
74 D A -2.7389
75 A A -1.9553
76 R A -2.9171
77 N A -1.9314
78 T A 0.0000
79 V A 0.0000
80 Y A -0.7516
81 L A 0.0000
82 Q A -1.4696
83 L A 0.0000
84 N A -1.3195
85 S A -1.1233
86 L A 0.0000
87 K A -2.0879
88 P A -1.7915
89 E A -2.2743
90 D A 0.0000
91 T A -0.8940
92 A A 0.0000
93 V A -0.6527
94 Y A 0.0000
95 Y A -0.4894
96 C A 0.0000
97 A A 0.0000
98 A A 0.0000
99 A A 0.2629
100 N A 0.5760
101 V A 0.8942
102 L A 1.7479
103 P A 0.5770
104 G A 0.2926
105 L A 0.8698
106 P A -0.1389
107 A A -0.4266
108 E A -1.3644
109 L A 0.1247
110 P A 0.1826
111 I A 0.8017
112 Y A 0.8202
113 W A 0.5261
114 G A -0.0473
115 Q A -1.0651
116 G A -0.6436
117 T A 0.0000
118 Q A -1.1518
119 V A 0.0000
120 T A -0.2117
121 V A 0.0000
122 S A -0.6234
123 S A -0.8952
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018