Project name: 37bfeb7951d794c

Status: done

Started: 2026-06-22 16:05:26
Settings
Chain sequence(s) B: ELAEIKAKMDGFMEAKKLMEEIAEQYGLPLNSESYKNFMKSLKKLEEALK
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:05)
Show buried residues

Minimal score value
-3.7141
Maximal score value
0.3208
Average score
-1.8316
Total score value
-91.5782

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E B -1.8931
2 L B -0.5118
3 A B -1.3772
4 E B -2.7671
5 I B -1.7229
6 K B -2.6904
7 A B -2.3817
8 K B -2.5196
9 M B -2.0738
10 D B -3.0129
11 G B -2.1220
12 F B -0.8083
13 M B -1.3621
14 E B -2.4105
15 A B -1.1239
16 K B -1.2492
17 K B -2.0718
18 L B -0.4074
19 M B -0.6437
20 E B -1.8698
21 E B -2.3006
22 I B -0.6473
23 A B 0.0000
24 E B -2.2017
25 Q B -1.6593
26 Y B 0.1198
27 G B -0.4268
28 L B 0.3208
29 P B -0.2646
30 L B -1.1372
31 N B -1.9744
32 S B -1.9129
33 E B -2.8977
34 S B -2.0937
35 Y B -2.0052
36 K B -3.1081
37 N B -3.0952
38 F B -1.6798
39 M B -2.0538
40 K B -3.3539
41 S B -2.5664
42 L B 0.0000
43 K B -3.7141
44 K B -3.5146
45 L B -2.1318
46 E B -3.1935
47 E B -3.4960
48 A B -1.9212
49 L B -1.4445
50 K B -2.2053
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018