Project name: query_structure

Status: done

Started: 2026-03-17 01:26:24
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVIFYVITYGETGGNSPVQEFTVPGSKSTATISGLSPGVDYTITVYATYYASNSGWYEYTSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:28)
Show buried residues

Minimal score value
-2.6473
Maximal score value
1.9622
Average score
-0.2757
Total score value
-26.4681

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7659
2 S A 0.7521
3 S A 0.6969
4 V A 0.3269
5 P A 0.0000
6 T A -1.5826
7 K A -2.5713
8 L A 0.0000
9 E A -1.8862
10 V A 0.1188
11 V A 1.5419
12 A A 0.8961
13 A A 0.3291
14 T A -0.1939
15 P A -0.7964
16 T A -0.5281
17 S A -0.3095
18 L A 0.0000
19 L A 0.7494
20 I A 0.0000
21 S A -0.9243
22 W A 0.0000
23 D A -2.4627
24 A A -1.1580
25 P A 0.0665
26 A A 0.5070
27 V A 1.0229
28 T A 0.7723
29 V A 1.1727
30 I A 1.4261
31 F A 0.9829
32 Y A 0.0000
33 V A 0.0000
34 I A 0.0000
35 T A -0.4127
36 Y A -0.2881
37 G A 0.0000
38 E A -1.5959
39 T A -1.5019
40 G A -1.3626
41 G A -1.5253
42 N A -1.5573
43 S A -0.8816
44 P A -0.3268
45 V A 0.4457
46 Q A -0.8329
47 E A -1.5353
48 F A -0.5363
49 T A -0.0810
50 V A 0.0000
51 P A -0.3733
52 G A -0.1597
53 S A -0.8686
54 K A -1.9040
55 S A -1.3524
56 T A -0.7509
57 A A 0.0000
58 T A 0.2412
59 I A 0.0000
60 S A -0.4735
61 G A -0.6854
62 L A 0.0000
63 S A -0.9398
64 P A -1.0811
65 G A -1.2477
66 V A -1.2606
67 D A -2.6207
68 Y A 0.0000
69 T A -0.9428
70 I A 0.0000
71 T A 0.0000
72 V A 0.0000
73 Y A 0.6648
74 A A 0.0000
75 T A 0.0000
76 Y A 1.8817
77 Y A 1.9622
78 A A 0.0000
79 S A -0.4149
80 N A -1.2329
81 S A -0.4931
82 G A -0.1361
83 W A 1.1618
84 Y A 1.7578
85 E A 0.9535
86 Y A 1.4358
87 T A 0.0000
88 S A 0.1364
89 P A 0.2479
90 I A 0.0813
91 S A -0.5100
92 I A -0.7205
93 N A -1.8953
94 Y A -1.6640
95 R A -2.6473
96 T A -1.3404
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018