Project name: 38565567d253036

Chain sequence(s)	A: NVPLSNCSVDPPNERHPPAYESAFKYKLPIVHPIKVAT
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:38)

• Minimal score value: -4.0207
• Maximal score value: 1.9594
• Average score: -0.1972
• Total score value: -7.4942

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	N	A	-0.4652
2	V	A	1.2539
3	P	A	0.7218
4	L	A	1.7853
5	S	A	0.6696
6	N	A	-0.2053
7	C	A	0.7220
8	S	A	0.1984
9	V	A	0.1686
10	D	A	-2.2891
11	P	A	-2.1525
12	P	A	-2.5738
13	N	A	-3.3810
14	E	A	-4.0200
15	R	A	-4.0207
16	H	A	-2.9949
17	P	A	-2.0339
18	P	A	-1.4669
19	A	A	-0.7982
20	Y	A	0.3184
21	E	A	-1.0662
22	S	A	-0.3126
23	A	A	0.3955
24	F	A	1.5061
25	K	A	0.1004
26	Y	A	0.8962
27	K	A	0.3810
28	L	A	1.0105
29	P	A	0.7127
30	I	A	1.7067
31	V	A	1.2226
32	H	A	0.3547
33	P	A	1.0117
34	I	A	1.9594
35	K	A	0.3304
36	V	A	1.4651
37	A	A	1.0110
38	T	A	0.3841