Project name: 386f921286d95bb

Status: done

Started: 2026-07-01 15:23:49
Settings
Chain sequence(s) B: GSSPSGVQRPVINSETGTVTVTMNMSDVSSATFVWTSGGEVIATSKVVSV
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:10)
Show buried residues

Minimal score value
-2.1142
Maximal score value
2.4468
Average score
0.0788
Total score value
3.9385

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G B -0.6546
2 S B -0.6516
3 S B -0.6670
4 P B -1.0480
5 S B -0.9422
6 G B -1.2225
7 V B -0.6762
8 Q B -1.5507
9 R B -1.4815
10 P B 0.4465
11 V B 1.9684
12 I B 1.6548
13 N B -0.1969
14 S B -0.9390
15 E B -2.1142
16 T B -1.1839
17 G B -0.9457
18 T B 0.1570
19 V B 1.5716
20 T B 1.0815
21 V B 0.9946
22 T B -0.1433
23 M B -0.6820
24 N B -1.5372
25 M B -0.2579
26 S B -1.1919
27 D B -1.7798
28 V B 0.0000
29 S B -0.1287
30 S B 0.6127
31 A B -0.0214
32 T B 0.0977
33 F B 0.9631
34 V B 2.2921
35 W B 2.0757
36 T B 0.8523
37 S B -0.1784
38 G B -0.9443
39 G B -1.0291
40 E B -0.8051
41 V B 1.7347
42 I B 2.4468
43 A B 1.8712
44 T B 1.1259
45 S B -0.0759
46 K B -0.9076
47 V B 0.5417
48 V B 1.7791
49 S B 1.4275
50 V B 2.2002
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018