Project name: query_structure

Status: done

Started: 2026-03-16 20:08:39
Settings
Chain sequence(s) A: ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:39)
Show buried residues

Minimal score value
-2.9553
Maximal score value
1.821
Average score
-0.4332
Total score value
-15.1623

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.8041
2 C A -1.0463
3 R A -0.3820
4 Y A 1.2166
5 W A 1.7984
6 L A 1.8210
7 G A 0.8105
8 G A 0.0972
9 C A -0.2641
10 S A -0.7756
11 A A -0.6555
12 G A -0.7666
13 Q A -1.1496
14 T A -0.7249
15 C A -0.2902
16 C A 0.0000
17 K A -1.9385
18 H A -1.5930
19 L A -0.1325
20 V A 0.0923
21 C A -0.3027
22 S A -1.1010
23 R A -2.8122
24 R A -2.9553
25 H A -1.5012
26 G A -1.4130
27 W A 0.2720
28 C A 0.0000
29 V A 0.0000
30 W A 0.8188
31 D A -0.8618
32 G A -0.5601
33 T A 0.0731
34 F A 0.8636
35 S A 0.0044
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018