Project name: design7

Status: done

Started: 2026-05-21 07:40:20
Settings
Chain sequence(s) A: KEHHTNPAIVEAKIEALKALITYCNRRAAELEKEGKTEAAKLLREMAKLYEEAIKLIKEGKHEEAAKLIYEANKLQLEVYKLLNASKEVIEKMQEILETRKNGSVVERCKLYIELVKDLDPTFTPEEKKAMSEALQKIIDAL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:06:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:55)
Show buried residues

Minimal score value
-3.6511
Maximal score value
0.0
Average score
-1.6669
Total score value
-236.7063

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 K A -2.8106
2 E A -2.7331
3 H A -1.6359
4 H A -2.0788
5 T A -1.5713
6 N A -1.4229
7 P A -1.1981
8 A A -1.1092
9 I A 0.0000
10 V A -1.7699
11 E A -2.6897
12 A A 0.0000
13 K A -1.6148
14 I A -2.3706
15 E A -2.7522
16 A A -1.7208
17 L A 0.0000
18 K A -2.0626
19 A A -1.3649
20 L A -0.7831
21 I A -1.6431
22 T A -0.7492
23 Y A 0.0000
24 C A 0.0000
25 N A -2.0166
26 R A -1.4707
27 R A -1.5497
28 A A 0.0000
29 A A -2.2745
30 E A -2.5813
31 L A 0.0000
32 E A -3.3379
33 K A -3.5053
34 E A -3.5403
35 G A -2.9085
36 K A -2.8828
37 T A -2.7255
38 E A -2.7886
39 A A 0.0000
40 A A 0.0000
41 K A -3.2528
42 L A 0.0000
43 L A 0.0000
44 R A -3.1706
45 E A -3.2608
46 M A 0.0000
47 A A 0.0000
48 K A -3.0994
49 L A -2.2022
50 Y A 0.0000
51 E A -3.2793
52 E A -2.7168
53 A A 0.0000
54 I A 0.0000
55 K A -3.4255
56 L A -3.1052
57 I A 0.0000
58 K A -3.6511
59 E A -3.4407
60 G A -2.8495
61 K A -3.1419
62 H A 0.0000
63 E A -3.0959
64 E A -2.9423
65 A A 0.0000
66 A A -1.9460
67 K A -2.6474
68 L A -1.8274
69 I A -1.1958
70 Y A -1.4320
71 E A -1.8283
72 A A 0.0000
73 N A 0.0000
74 K A -1.5267
75 L A -1.5099
76 Q A 0.0000
77 L A -1.3295
78 E A -2.3412
79 V A 0.0000
80 Y A 0.0000
81 K A -2.3527
82 L A -1.1485
83 L A -1.0984
84 N A -1.8918
85 A A -1.5498
86 S A -2.2537
87 K A -3.4153
88 E A -3.3983
89 V A 0.0000
90 I A -2.6967
91 E A -3.1950
92 K A -2.6100
93 M A 0.0000
94 Q A -2.4881
95 E A -2.9730
96 I A 0.0000
97 L A -2.6562
98 E A -3.5875
99 T A -3.1355
100 R A -3.1214
101 K A -3.4099
102 N A -3.0868
103 G A -2.2099
104 S A -1.2518
105 V A -0.4257
106 V A -0.9281
107 E A -2.2405
108 R A -2.1545
109 C A 0.0000
110 K A -2.1331
111 L A -1.6371
112 Y A -1.0949
113 I A -1.8412
114 E A -2.2310
115 L A 0.0000
116 V A 0.0000
117 K A -2.3879
118 D A -2.6375
119 L A -1.7082
120 D A 0.0000
121 P A -0.7178
122 T A -0.3166
123 F A 0.0000
124 T A -1.2764
125 P A -1.9123
126 E A -2.7158
127 E A -1.9199
128 K A -2.7350
129 K A -3.1908
130 A A -2.5004
131 M A 0.0000
132 S A -2.5030
133 E A -2.9534
134 A A 0.0000
135 L A 0.0000
136 Q A -2.1758
137 K A -2.5540
138 I A 0.0000
139 I A -1.4761
140 D A -1.8530
141 A A -1.0175
142 L A -0.0578
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018