Project name: query_structure

Status: done

Started: 2026-03-16 23:09:37
Settings
Chain sequence(s) A: ESCVWIPCISAAIGCSCKSKVCYRNGIPCG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:37)
Show buried residues

Minimal score value
-1.8788
Maximal score value
2.3117
Average score
0.2449
Total score value
7.3484

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -0.0832
2 S A 0.1463
3 C A 0.7826
4 V A 1.0264
5 W A 1.9492
6 I A 2.2557
7 P A 1.3438
8 C A 0.0000
9 I A 2.3117
10 S A 1.4044
11 A A 1.1800
12 A A 1.4252
13 I A 2.0669
14 G A 0.4874
15 C A 0.0000
16 S A -0.3399
17 C A -0.4905
18 K A -1.8788
19 S A -1.3580
20 K A -1.3647
21 V A -0.6755
22 C A 0.0000
23 Y A -0.6822
24 R A -0.9729
25 N A -1.4270
26 G A -0.6746
27 I A 0.9213
28 P A -0.0028
29 C A 0.2309
30 G A -0.2333
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018