Project name: 4A12

Chain sequence(s)	A: ARVEQTPTTTTKEAGESLTINCVLRDSSCPLPSASTYWFFTKKGATKKESLSNGGRYAETMNKTSKSFSLRISDLRVEDSGTYHCKAYPGGYCDGIYYYEGGGTILTV
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:47)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:47)

• Minimal score value: -3.49
• Maximal score value: 2.5417
• Average score: -0.763
• Total score value: -82.4064

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	A	A	-1.9942
2	R	A	-3.1364
3	V	A	0.0000
4	E	A	-1.8377
5	Q	A	0.0000
6	T	A	-0.4123
7	P	A	-0.1665
8	T	A	0.1025
9	T	A	0.5293
10	T	A	0.2887
11	T	A	-0.2851
12	K	A	-1.3727
13	E	A	-2.4039
14	A	A	-1.8875
15	G	A	-2.2018
16	E	A	-2.5036
17	S	A	-1.9569
18	L	A	0.0000
19	T	A	-0.9387
20	I	A	0.0000
21	N	A	-1.0652
22	C	A	0.0000
23	V	A	-1.2560
24	L	A	0.0000
25	R	A	-2.9115
26	D	A	-2.9258
27	S	A	0.0000
28	S	A	-0.8928
29	C	A	0.0000
30	P	A	-0.7632
31	L	A	0.0000
32	P	A	-0.7900
33	S	A	-0.6136
34	A	A	0.1566
35	S	A	0.0000
36	T	A	0.3220
37	Y	A	0.6633
38	W	A	0.0000
39	F	A	-0.7224
40	F	A	-1.3697
41	T	A	-2.2806
42	K	A	-2.8203
43	K	A	-2.2198
44	G	A	-1.7483
45	A	A	-1.8658
46	T	A	-2.0148
47	K	A	-3.2001
48	K	A	-3.4900
49	E	A	-3.1160
50	S	A	-1.0508
51	L	A	-0.5826
52	S	A	-0.9377
53	N	A	-1.8357
54	G	A	-1.4668
55	G	A	-1.2004
56	R	A	-1.7276
57	Y	A	-1.5976
58	A	A	-1.4820
59	E	A	-1.2511
60	T	A	-0.8907
61	M	A	-0.9830
62	N	A	-1.8771
63	K	A	-2.3284
64	T	A	-1.3339
65	S	A	-1.2458
66	K	A	-1.5254
67	S	A	-1.2007
68	F	A	0.0000
69	S	A	-0.9378
70	L	A	0.0000
71	R	A	-1.9646
72	I	A	0.0000
73	S	A	-1.9563
74	D	A	-2.7699
75	L	A	0.0000
76	R	A	-1.7006
77	V	A	0.0515
78	E	A	-1.4795
79	D	A	0.0000
80	S	A	0.0000
81	G	A	0.0000
82	T	A	-0.1811
83	Y	A	0.0000
84	H	A	-0.5961
85	C	A	0.0000
86	K	A	-0.5538
87	A	A	0.0000
88	Y	A	0.8836
89	P	A	0.0000
90	G	A	0.2940
91	G	A	0.7249
92	Y	A	1.9651
93	C	A	1.0704
94	D	A	0.4748
95	G	A	1.0588
96	I	A	2.3884
97	Y	A	2.5417
98	Y	A	1.1475
99	Y	A	-0.7621
100	E	A	-2.1219
101	G	A	0.0000
102	G	A	-1.1573
103	G	A	0.0000
104	T	A	0.0000
105	I	A	1.2801
106	L	A	0.0000
107	T	A	-0.1335
108	V	A	-0.3546