Project name: 3930d390f192972

Chain sequence(s)	A: NFMLTQPHSVSESPGKTLTISCTGSSASIASHYVQWYQQRPGGAPTTLIYENDQRPSEVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDGNNHWVFGGGTKLTVL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:40)

• Minimal score value: -2.8831
• Maximal score value: 1.786
• Average score: -0.741
• Total score value: -82.2508

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	N	A	-1.1964
2	F	A	-0.1183
3	M	A	0.9529
4	L	A	0.0000
5	T	A	0.0687
6	Q	A	0.0000
7	P	A	-0.8925
8	H	A	-1.5962
9	S	A	-1.2294
10	V	A	-0.5978
11	S	A	-0.2116
12	E	A	-0.4423
13	S	A	-0.3918
14	P	A	-0.9708
15	G	A	-1.6210
16	K	A	-1.9285
17	T	A	-1.0976
18	L	A	-0.3837
19	T	A	-0.0898
20	I	A	0.0000
21	S	A	-0.1157
22	C	A	0.0000
23	T	A	-0.2508
24	G	A	0.0000
25	S	A	-0.1110
26	S	A	-0.2699
27	A	A	-0.3226
28	S	A	-0.5866
29	I	A	0.0000
30	A	A	-0.2445
31	S	A	-0.3932
32	H	A	-0.5393
33	Y	A	0.0428
34	V	A	0.0000
35	Q	A	-0.3727
36	W	A	0.0000
37	Y	A	-0.0065
38	Q	A	0.0000
39	Q	A	-1.8680
40	R	A	-2.8831
41	P	A	-1.6823
42	G	A	-1.1664
43	G	A	-1.1635
44	A	A	-0.6651
45	P	A	-0.7784
46	T	A	-0.3902
47	T	A	-0.0200
48	L	A	0.0000
49	I	A	0.0000
50	Y	A	-0.8324
51	E	A	-1.6250
52	N	A	-1.5793
53	D	A	-2.6260
54	Q	A	-2.3544
55	R	A	-2.2363
56	P	A	-1.1799
57	S	A	-1.5207
58	E	A	-2.2025
59	V	A	-1.4634
60	P	A	-1.6174
61	D	A	-2.3680
62	R	A	-1.2768
63	F	A	0.0000
64	S	A	-1.3874
65	G	A	-1.3470
66	S	A	-1.1686
67	I	A	-0.6283
68	D	A	-1.3382
69	S	A	-0.9889
70	S	A	-0.8290
71	S	A	-0.8141
72	N	A	-0.8588
73	S	A	-0.6919
74	A	A	0.0000
75	S	A	-0.5647
76	L	A	0.0000
77	T	A	-0.2035
78	I	A	0.0000
79	S	A	-1.1802
80	G	A	-1.4500
81	L	A	0.0000
82	K	A	-2.2370
83	T	A	-1.6389
84	E	A	-2.6777
85	D	A	0.0000
86	E	A	-2.5811
87	A	A	0.0000
88	D	A	-2.2082
89	Y	A	0.0000
90	Y	A	-0.0041
91	C	A	0.0000
92	Q	A	0.0000
93	S	A	0.0000
94	Y	A	-0.4379
95	D	A	-1.8034
96	G	A	-1.7200
97	N	A	-2.2215
98	N	A	-2.1049
99	H	A	-1.5276
100	W	A	0.5274
101	V	A	1.1037
102	F	A	1.7860
103	G	A	0.6451
104	G	A	-0.3478
105	G	A	-0.8018
106	T	A	0.0000
107	K	A	-2.3570
108	L	A	0.0000
109	T	A	-0.6221
110	V	A	-0.2922
111	L	A	1.1360