Project name: REST_test

Status: done

Started: 2025-02-28 09:44:18
Settings
Chain sequence(s) A: IQKVQDDTKTLIKTIVTRINDILDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPEASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
input PDB
Selected Chain(s) A
Distance of aggregation 5 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:26)
Show buried residues

Minimal score value
-2.0533
Maximal score value
1.9503
Average score
-0.232
Total score value
-30.1578

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
3 I A 1.8189
4 Q A -1.1645
5 K A -1.9624
6 V A 0.1085
7 Q A -0.4100
8 D A -1.2982
9 D A -1.9243
10 T A 0.0000
11 K A -0.6416
12 T A -0.1500
13 L A 0.1898
14 I A 0.0000
15 K A -1.4662
16 T A -0.2966
17 I A 0.0000
18 V A 0.1779
19 T A -0.1158
20 R A -0.4970
21 I A 0.0000
22 N A -1.6096
23 D A -1.6579
24 I A 1.6828
39 L A 0.5837
40 D A -1.2583
41 F A 1.6552
42 I A 0.5878
43 P A -0.2168
44 G A -0.1444
45 L A 0.0000
46 H A -0.9958
47 P A 0.0750
48 I A 1.6915
49 L A 1.1610
50 T A 0.1275
51 L A 0.0000
52 S A -0.1958
53 K A -0.9864
54 M A 0.0000
55 D A 0.0000
56 Q A -0.3353
57 T A 0.0000
58 L A 0.0000
59 A A 0.0063
60 V A 0.0000
61 Y A 0.0000
62 Q A -0.1737
63 Q A -0.3387
64 I A 0.0000
65 L A 0.0000
66 T A -0.1098
67 S A -0.2050
68 M A 0.0279
69 P A -0.2643
70 S A -0.5506
71 R A -1.9076
72 N A -0.5820
73 V A 0.0000
74 I A 1.2663
75 Q A -0.3016
76 I A 0.0000
77 S A -0.1202
78 N A -1.2771
79 D A 0.0000
80 L A 0.0000
81 E A -2.0533
82 N A -1.6067
83 L A 0.0000
84 R A -0.7079
85 D A -1.8197
86 L A -0.1148
87 L A 0.0000
88 H A -0.1292
89 V A 0.8238
90 L A 0.0000
91 A A 0.0000
92 F A 1.9503
93 S A 0.0617
94 K A -0.5307
95 S A -0.0703
96 C A -0.0799
97 H A -0.9319
98 L A -0.0573
99 P A -0.5632
100 E A -1.8645
101 A A -0.3554
102 S A -0.2970
103 G A -0.4289
104 L A -0.0173
105 E A -1.7495
106 T A -0.3021
107 L A 0.0415
108 D A -1.7592
109 S A -0.5411
110 L A 0.0000
111 G A -0.3381
112 G A -0.4230
113 V A 0.4095
114 L A 0.0000
115 E A -1.8170
116 A A -0.3611
117 S A -0.2956
118 G A -0.3210
119 Y A 0.8941
120 S A 0.0524
121 T A -0.3517
122 E A -1.5040
123 V A 0.3991
124 V A 0.0000
125 A A 0.0000
126 L A 0.0000
127 S A -0.0608
128 R A -0.2300
129 L A 0.0000
130 Q A -0.2799
131 G A -0.2153
132 S A 0.0000
133 L A 0.0000
134 Q A -1.1782
135 D A -0.6087
136 M A 0.0000
137 L A 0.3130
138 W A 1.2258
139 Q A 0.0000
140 L A 0.0000
141 D A -1.5009
142 L A 1.1754
143 S A 0.0690
144 P A 0.0000
145 G A -0.3184
146 C A 0.2076
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018