Project name: c93e2139c5c3f8ac47aa7864f0bf03b4

Status: done

Started: 2026-03-07 00:18:22
Settings
Chain sequence(s) B: CGSGVDEKTLERQKKLKEEAKEYEEKSEELEEEVRRAQEEAFRQRRENGDRVVSAANLTEEEAKRWTKLTELSKKLQYYATKSKELEKETDKLA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:06:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:36)
Show buried residues

Minimal score value
-5.3957
Maximal score value
1.1656
Average score
-2.7994
Total score value
-263.1442

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 C B 0.3918
2 G B 0.0542
3 S B -0.4606
4 G B -1.0212
5 V B -1.1644
6 D B -3.1986
7 E B -3.8955
8 K B -4.0770
9 T B -2.9857
10 L B -2.6661
11 E B -4.6944
12 R B -4.7035
13 Q B -4.3657
14 K B -4.7061
15 K B -4.7994
16 L B 0.0000
17 K B -5.3617
18 E B -5.3957
19 E B -4.6798
20 A B 0.0000
21 K B -5.3088
22 E B -4.8094
23 Y B -4.0328
24 E B -5.1644
25 E B -5.0631
26 K B -4.1110
27 S B -4.0989
28 E B -4.6669
29 E B -4.5085
30 L B 0.0000
31 E B -4.3995
32 E B -4.3202
33 E B -3.9332
34 V B -3.7576
35 R B -4.4811
36 R B -4.4711
37 A B 0.0000
38 Q B -3.2897
39 E B -4.1585
40 E B -3.7551
41 A B 0.0000
42 F B -2.8330
43 R B -4.4457
44 Q B -4.4154
45 R B -3.9405
46 R B -5.1548
47 E B -4.7844
48 N B -4.2258
49 G B -3.4007
50 D B -3.6928
51 R B -1.6622
52 V B 1.1656
53 V B 1.0612
54 S B 0.4964
55 A B 0.0486
56 A B -0.1065
57 N B -0.4226
58 L B -0.6444
59 T B -1.8746
60 E B -3.1840
61 E B -3.3359
62 E B -2.3527
63 A B -2.1554
64 K B -3.1043
65 R B -2.4495
66 W B -1.0263
67 T B -1.6326
68 K B -2.3642
69 L B -1.8391
70 T B -1.7821
71 E B -2.9763
72 L B -2.1323
73 S B -2.1872
74 K B -2.8831
75 K B -2.2250
76 L B -2.4383
77 Q B -1.7927
78 Y B -0.3706
79 Y B -1.8744
80 A B -2.0067
81 T B -1.5796
82 K B -2.1416
83 S B -3.9695
84 K B -3.6697
85 E B -3.9606
86 L B -4.1758
87 E B -4.5909
88 K B -4.4836
89 E B -4.2896
90 T B 0.0000
91 D B -3.7832
92 K B -3.2162
93 L B -1.4948
94 A B -0.7856
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018