Project name: 52_rank

Status: done

Started: 2026-05-18 11:33:52
Settings
Chain sequence(s) B: SVEGKTFHTPQEVIDFVMKEAGLHRHEVEYLLFQNPELTYTEKAKYIVEQYKPA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:37)
Show buried residues

Minimal score value
-3.5776
Maximal score value
1.3655
Average score
-1.2522
Total score value
-67.6202

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B -1.3508
2 V B -1.7523
3 E B -2.4680
4 G B -1.8136
5 K B -1.9431
6 T B -1.3279
7 F B 0.0000
8 H B -1.4583
9 T B -1.2367
10 P B -1.4506
11 Q B -2.3224
12 E B -2.3449
13 V B 0.0000
14 I B 0.0000
15 D B -2.7771
16 F B -1.7498
17 V B 0.0000
18 M B -2.3687
19 K B -2.6027
20 E B -1.9258
21 A B 0.0000
22 G B -1.6825
23 L B -1.9097
24 H B -2.7920
25 R B -3.5776
26 H B -2.6969
27 E B -2.6132
28 V B 0.0000
29 E B -1.0684
30 Y B 0.1380
31 L B 0.0000
32 L B 0.0000
33 F B 1.3655
34 Q B -0.3795
35 N B -0.6883
36 P B -1.0029
37 E B -1.9620
38 L B -0.9406
39 T B -0.8059
40 Y B -0.5294
41 T B -1.1728
42 E B -1.3567
43 K B -0.6729
44 A B 0.0000
45 K B -1.8425
46 Y B -0.9214
47 I B 0.0000
48 V B 0.0000
49 E B -2.6711
50 Q B -2.0574
51 Y B -1.0264
52 K B -2.0789
53 P B -1.1253
54 A B -0.6567
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018