Project name: 39fd693f2f07fab

Status: done

Started: 2026-06-22 16:05:01
Settings
Chain sequence(s) B: AALDALMAALEERYAKTKAVMDELLALGQITPEQKEKMLALAEKLREAAL
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:58)
Show buried residues

Minimal score value
-3.853
Maximal score value
1.3685
Average score
-1.2736
Total score value
-63.6799

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A B 0.1260
2 A B 0.5918
3 L B 1.3685
4 D B -0.3846
5 A B 0.1054
6 L B 0.8305
7 M B -0.3138
8 A B -1.0946
9 A B -1.1917
10 L B -1.8361
11 E B -3.2952
12 E B -3.7721
13 R B -3.8530
14 Y B -2.6695
15 A B -2.5611
16 K B -3.0351
17 T B -1.9975
18 K B -2.2204
19 A B -1.1650
20 V B 0.0091
21 M B -0.8312
22 D B -1.1432
23 E B -1.1941
24 L B -0.2833
25 L B -0.3436
26 A B 0.1200
27 L B 0.7129
28 G B -0.3062
29 Q B -0.9552
30 I B -0.9555
31 T B -1.5880
32 P B -2.2608
33 E B -3.5693
34 Q B -3.2877
35 K B -2.8986
36 E B -3.7047
37 K B -3.2493
38 M B -1.7732
39 L B -1.5789
40 A B -1.3013
41 L B -0.4038
42 A B -1.2363
43 E B -1.9326
44 K B -1.6741
45 L B 0.1216
46 R B -1.2158
47 E B -1.6901
48 A B -0.5274
49 A B 0.5053
50 L B 1.1229
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018