Project name: 3a0160fc5d75594

Status: done

Started: 2026-03-01 13:55:09
Settings
Chain sequence(s) A: ARLQIQLPSSSDDFKFQVWRKMFRALMPVTEELTFDPSSAHPSLVVSPSGRRVECSEQKAPPAGDDPRQFDKAVAVVAKQQLSEGEHYWEVEVGDKPRWALGVIAADASRRGKLHAVPSQGLWLLGLRDGKILEAHVEAKEPRVLRTPERRPTRIGIYLSFADGVLTFYDASDPDALVPLFTFHERLPGPVYPFFDVCWHDKGKNSQPLLLVGP
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:56)
Show buried residues

Minimal score value
-3.3571
Maximal score value
1.9211
Average score
-0.8718
Total score value
-186.5752

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A -0.5696
2 R A -1.1320
3 L A 0.5137
4 Q A -0.0839
5 I A 1.4396
6 Q A 0.2845
7 L A 1.1628
8 P A 0.4607
9 S A -0.1600
10 S A -0.4043
11 S A -1.0294
12 D A -1.9422
13 D A -0.9279
14 F A 0.5827
15 K A -0.4512
16 F A 0.2189
17 Q A -0.6996
18 V A 0.2262
19 W A 0.4481
20 R A -1.5053
21 K A -1.4622
22 M A 0.5016
23 F A 0.7249
24 R A 0.1430
25 A A 0.7960
26 L A 1.9211
27 M A 1.1040
28 P A 0.7045
29 V A 1.3193
30 T A 0.2352
31 E A -1.0152
32 E A -1.9246
33 L A 0.0000
34 T A -1.6467
35 F A 0.0000
36 D A -1.2826
37 P A -0.4865
38 S A -1.0752
39 S A 0.0000
40 A A 0.0000
41 H A 0.0000
42 P A -0.4888
43 S A 0.0000
44 L A 0.0000
45 V A 0.9032
46 V A -0.1985
47 S A -0.6674
48 P A -0.6165
49 S A -0.9695
50 G A 0.0000
51 R A -2.0016
52 R A -1.9847
53 V A 0.0000
54 E A -0.8675
55 C A 0.0000
56 S A -1.6514
57 E A -3.3571
58 Q A -2.9911
59 K A -2.8313
60 A A -1.6402
61 P A -0.9750
62 P A -0.8865
63 A A -1.1773
64 G A -1.7553
65 D A -2.6820
66 D A -2.4481
67 P A -2.2473
68 R A -2.9162
69 Q A -2.2070
70 F A 0.0000
71 D A -2.1521
72 K A -2.3427
73 A A -1.3150
74 V A 0.0000
75 A A 0.0000
76 V A 0.0000
77 V A 0.0000
78 A A 0.0000
79 K A -2.1945
80 Q A -1.9626
81 Q A -1.6867
82 L A 0.0000
83 S A -1.6968
84 E A -2.5736
85 G A -2.2708
86 E A -2.4084
87 H A -1.0750
88 Y A 0.0000
89 W A 0.0000
90 E A 0.0000
91 V A 0.0000
92 E A -1.1785
93 V A 0.0000
94 G A -1.5494
95 D A -2.3442
96 K A 0.0000
97 P A -2.4400
98 R A -2.0936
99 W A 0.0000
100 A A -0.3567
101 L A 0.0000
102 G A 0.0000
103 V A 0.0000
104 I A 0.0000
105 A A -0.9408
106 A A -1.3067
107 D A -2.1969
108 A A -1.4972
109 S A -1.5534
110 R A 0.0000
111 R A -2.1554
112 G A -1.9769
113 K A -2.5550
114 L A -1.7746
115 H A -1.8260
116 A A -1.5810
117 V A 0.0000
118 P A -1.2654
119 S A -1.3326
120 Q A -1.9398
121 G A 0.0000
122 L A 0.0000
123 W A 0.0000
124 L A 0.0000
125 L A 0.0000
126 G A 0.0000
127 L A 0.0000
128 R A -2.5613
129 D A -2.9487
130 G A 0.0000
131 K A -3.2368
132 I A -1.4233
133 L A 0.0000
134 E A 0.0000
135 A A 0.0000
136 H A -1.4373
137 V A -1.8419
138 E A -2.8067
139 A A -2.6151
140 K A -3.3014
141 E A -3.1745
142 P A -2.0801
143 R A -2.0249
144 V A 0.3291
145 L A -0.2188
146 R A -1.8656
147 T A -1.7673
148 P A -2.0435
149 E A -3.0021
150 R A -2.6924
151 R A -2.7546
152 P A 0.0000
153 T A -1.5128
154 R A -1.1511
155 I A 0.0000
156 G A 0.0000
157 I A 0.0000
158 Y A -0.1829
159 L A 0.0000
160 S A 0.0000
161 F A 0.0000
162 A A -1.8027
163 D A -2.5556
164 G A 0.0000
165 V A -1.4441
166 L A 0.0000
167 T A 0.0000
168 F A 0.0000
169 Y A 0.0000
170 D A 0.0000
171 A A 0.0000
172 S A -1.2081
173 D A -1.7824
174 P A -1.9307
175 D A -2.3132
176 A A -1.3963
177 L A 0.0000
178 V A 1.2252
179 P A 0.7326
180 L A 0.3759
181 F A 0.1896
182 T A -0.1740
183 F A 0.0000
184 H A -1.9064
185 E A -2.3772
186 R A -2.7734
187 L A 0.0000
188 P A -1.1294
189 G A -1.2221
190 P A -1.1285
191 V A 0.0000
192 Y A -0.7243
193 P A 0.0000
194 F A 0.0000
195 F A 0.0000
196 D A -0.1972
197 V A 0.0000
198 C A -0.1610
199 W A -0.6147
200 H A -1.8446
201 D A -2.2707
202 K A -2.9392
203 G A -2.4988
204 K A -2.6148
205 N A 0.0000
206 S A -1.6756
207 Q A -1.3139
208 P A -1.0473
209 L A 0.0000
210 L A -0.9682
211 L A 0.0000
212 V A -0.5196
213 G A -0.6857
214 P A -0.3538
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018