Project name: 6J4C_analysis

Status: done

Started: 2026-04-23 09:37:49
Settings
Chain sequence(s) A: PADPEIVEGLPIPLAVAGHHQPAPFYLTADMFGGLPVQLAGGELSTLVGKPVAAPHTHPVDELYLLVSPNKGGARIEVQLDGRRHELLSPAVMRIPAGSEHCFLTLEAEVGSYCFGILLGDRL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:58)
Show buried residues

Minimal score value
-3.645
Maximal score value
1.9387
Average score
-0.4486
Total score value
-55.1828

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
7 P A -0.6031
8 A A -0.7860
9 D A -1.5084
10 P A -0.8346
11 E A -1.0598
12 I A 0.4133
13 V A 0.2654
14 E A -1.1691
15 G A -0.4765
16 L A 0.2328
17 P A 0.3133
18 I A 0.6306
19 P A 0.0758
20 L A 0.2469
21 A A -0.1307
22 V A 0.0248
23 A A -0.1265
24 G A -0.4910
25 H A -0.8596
26 H A -1.5612
27 Q A -1.6413
28 P A -0.7260
29 A A 0.0000
30 P A 0.1332
31 F A 0.0000
32 Y A 0.6489
33 L A 0.9112
34 T A 0.0000
35 A A -1.4328
36 D A -1.8191
37 M A -0.3282
38 F A 0.7086
39 G A -0.3787
40 G A -1.0144
41 L A -0.5085
42 P A -0.8468
43 V A -0.2628
44 Q A 0.0000
45 L A 0.9331
46 A A 0.4802
47 G A 0.2171
48 G A -0.1975
49 E A -0.1720
50 L A 0.0000
51 S A 0.2880
52 T A 0.1087
53 L A -0.1441
54 V A -0.0550
55 G A -0.7228
56 K A -1.2801
57 P A -0.5443
58 V A -0.2797
59 A A -0.4088
60 A A -0.3648
61 P A -0.9911
62 H A -1.0072
63 T A -0.9192
64 H A 0.0000
65 P A -0.6123
66 V A -0.4294
67 D A -0.4839
68 E A 0.0000
69 L A 0.4953
70 Y A 0.0000
71 L A 1.4511
72 L A 0.0000
73 V A 0.4977
74 S A -0.5098
75 P A -1.0195
76 N A -2.1962
77 K A -2.3737
78 G A -1.5225
79 G A -1.3684
80 A A 0.0000
81 R A -0.5923
82 I A 0.0000
83 E A 0.0000
84 V A 0.0000
85 Q A -2.6219
86 L A 0.0000
87 D A -3.3401
88 G A -3.0490
89 R A -3.6450
90 R A -3.5498
91 H A -2.1833
92 E A -1.0714
93 L A 0.4701
94 L A 0.5550
95 S A 0.0000
96 P A 0.1140
97 A A 1.2157
98 V A 1.9387
99 M A 0.1862
100 R A -1.2162
101 I A 0.0000
102 P A -0.9486
103 A A -0.7417
104 G A -1.1568
105 S A -1.6371
106 E A -2.4274
107 H A 0.0000
108 C A 0.0000
109 F A -0.1761
110 L A -0.1276
111 T A 0.0000
112 L A -0.4787
113 E A -1.4008
114 A A -0.4565
115 E A -0.1529
116 V A 1.2487
117 G A 0.4000
118 S A 0.0000
119 Y A 0.6137
120 C A 0.0000
121 F A 0.9883
122 G A 0.0000
123 I A 0.8032
124 L A 0.0000
125 L A 0.2975
126 G A -0.9212
127 D A -2.5810
128 R A -2.1535
129 L A -0.2936
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018