Project name: obj1 [mutate: LQ11C, WC47C, LI115C, TW117C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	TW117C,LQ11C,WC47C,LI115C
Energy difference between WT (input) and mutated protein (by FoldX)	2.71343 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:35)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:59)

• Minimal score value: -3.324
• Maximal score value: 2.023
• Average score: -0.6702
• Total score value: -80.4275

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0063
2	V	C	-0.9165
3	Q	C	-1.2443
4	L	C	0.0000
5	V	C	0.5671
6	E	C	0.2706
7	S	C	-0.3603
8	G	C	-0.7597
9	G	C	-0.2708
10	G	C	-0.0221
11	Q	C	-0.8745	mutated: LQ11C
12	V	C	-1.0968
13	Q	C	-1.7916
14	P	C	-1.6726
15	G	C	-1.4104
16	G	C	-1.2643
17	S	C	-1.2270
18	L	C	-1.2813
19	R	C	-2.1465
20	L	C	0.0000
21	S	C	-0.5421
22	C	C	0.0000
23	A	C	-0.2017
24	A	C	0.0000
25	S	C	-0.2017
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2524
29	F	C	0.0000
30	R	C	-2.0330
31	S	C	-0.8870
32	Y	C	-1.2169
33	E	C	-1.1379
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.2034
40	A	C	-0.8314
41	P	C	-1.2918
42	G	C	-1.4348
43	K	C	-2.1350
44	G	C	-1.0592
45	L	C	0.4680
46	E	C	-0.2348
47	C	C	0.6701	mutated: WC47C
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5371
53	G	C	-1.2460
54	S	C	-1.2291
55	G	C	-1.0820
56	G	C	-0.7344
57	S	C	-0.2365
58	T	C	0.3551
59	Y	C	0.9406
60	Y	C	-0.1127
61	A	C	-0.9776
62	D	C	-2.2977
63	S	C	-1.7062
64	V	C	0.0000
65	K	C	-2.3272
66	G	C	-1.6103
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6304
70	I	C	0.0000
71	S	C	-0.5622
72	R	C	-1.3627
73	D	C	-1.9805
74	N	C	-2.1902
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6491
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6696
81	L	C	0.0000
82	Q	C	-1.2335
83	M	C	0.0000
84	N	C	-1.3326
85	S	C	-1.2322
86	L	C	0.0000
87	R	C	-2.3607
88	A	C	-1.7102
89	E	C	-2.2220
90	D	C	0.0000
91	T	C	0.0000
92	A	C	0.0000
93	I	C	1.4079
94	Y	C	0.0000
95	Y	C	0.7386
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1906
101	D	C	-3.3240
102	G	C	-2.0591
103	F	C	-1.1358
104	N	C	-2.4023
105	K	C	-3.1741
106	G	C	-1.9080
107	F	C	-1.0045
108	D	C	-1.1121
109	Y	C	-0.2179
110	W	C	0.5530
111	G	C	-0.0665
112	Q	C	-0.8737
113	G	C	0.2123
114	T	C	0.7852
115	I	C	2.0230	mutated: LI115C
116	V	C	0.0000
117	W	C	0.4136	mutated: TW117C
118	V	C	0.0000
119	S	C	-1.0902
120	S	C	-0.9768