Project name: obj1 [mutate: EQ89C, TD91C, IL93C, YS95C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	IL93C,EQ89C,TD91C,YS95C
Energy difference between WT (input) and mutated protein (by FoldX)	6.95069 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:42)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:05)

• Minimal score value: -3.331
• Maximal score value: 1.5898
• Average score: -0.6602
• Total score value: -79.2293

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0065
2	V	C	-0.9142
3	Q	C	-1.2418
4	L	C	0.0000
5	V	C	0.5407
6	E	C	0.1822
7	S	C	-0.4144
8	G	C	-0.8279
9	G	C	-0.0433
10	G	C	0.8103
11	L	C	1.3554
12	V	C	-0.1110
13	Q	C	-1.3386
14	P	C	-1.4704
15	G	C	-1.3997
16	G	C	-0.9751
17	S	C	-1.2300
18	L	C	-0.9772
19	R	C	-2.1482
20	L	C	0.0000
21	S	C	-0.5426
22	C	C	0.0000
23	A	C	-0.2040
24	A	C	0.0000
25	S	C	-0.2017
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2525
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1434
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.3841
40	A	C	-0.9862
41	P	C	-1.3152
42	G	C	-1.4207
43	K	C	-2.1021
44	G	C	-0.9876
45	L	C	0.5000
46	E	C	-0.3127
47	W	C	0.3572
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5831
53	G	C	-1.2447
54	S	C	-1.2286
55	G	C	-1.0817
56	G	C	-0.7345
57	S	C	-0.3025
58	T	C	0.1989
59	Y	C	0.6077
60	Y	C	-0.3559
61	A	C	-1.1374
62	D	C	-2.3443
63	S	C	-1.6448
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6174
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6722
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6491
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6697
81	L	C	0.0000
82	Q	C	-1.2344
83	M	C	0.0000
84	N	C	-1.3233
85	S	C	-1.2134
86	L	C	0.0000
87	R	C	-2.2666
88	A	C	-1.6651
89	Q	C	-1.8161	mutated: EQ89C
90	D	C	0.0000
91	D	C	-0.6079	mutated: TD91C
92	A	C	0.0000
93	L	C	0.8035	mutated: IL93C
94	Y	C	0.0000
95	S	C	0.0000	mutated: YS95C
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1855
101	D	C	-3.3310
102	G	C	-2.0845
103	F	C	-1.2288
104	N	C	-2.4263
105	K	C	-3.1814
106	G	C	-1.8996
107	F	C	-0.9628
108	D	C	-1.0872
109	Y	C	-0.1931
110	W	C	0.5446
111	G	C	-0.1256
112	Q	C	-0.9373
113	G	C	-0.0118
114	T	C	0.4748
115	L	C	1.5898
116	V	C	0.0000
117	T	C	0.2171
118	V	C	0.0000
119	S	C	-0.7463
120	S	C	-0.9954