Project name: query_structure

Status: done

Started: 2026-03-17 01:28:35
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVVYYVITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAMYYYQEEYMYSSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:19)
Show buried residues

Minimal score value
-2.761
Maximal score value
2.2208
Average score
-0.2971
Total score value
-27.9294

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.8067
2 S A 0.8264
3 S A 1.0422
4 V A 0.7691
5 P A 0.0000
6 T A -1.2771
7 K A -2.3542
8 L A 0.0000
9 E A -1.7681
10 V A 0.1437
11 V A 1.5433
12 A A 0.9010
13 A A 0.3282
14 T A -0.3297
15 P A -1.0374
16 T A -0.9535
17 S A -0.5225
18 L A 0.0000
19 L A 0.7706
20 I A 0.0000
21 S A -0.7660
22 W A 0.0000
23 D A -1.6808
24 A A -0.7641
25 P A 0.3015
26 A A 0.6108
27 V A 1.2418
28 T A 0.8732
29 V A 1.2270
30 V A 1.6132
31 Y A 0.6225
32 Y A 0.0000
33 V A 0.0000
34 I A 0.0000
35 T A 0.0000
36 Y A -0.2693
37 G A 0.0000
38 E A -1.8423
39 T A -1.5390
40 G A -1.3693
41 G A -1.5452
42 N A -1.5674
43 S A -0.9056
44 P A -0.3475
45 V A 0.4166
46 Q A -0.8459
47 E A -1.5148
48 F A -0.4923
49 T A -0.0816
50 V A 0.0000
51 P A -0.4572
52 G A -0.2382
53 S A -0.9105
54 K A -1.9457
55 S A -1.1781
56 T A -0.6469
57 A A 0.0000
58 T A 0.2471
59 I A 0.0000
60 S A -0.6564
61 G A -1.0260
62 L A 0.0000
63 K A -2.3888
64 P A -1.5907
65 G A -1.2994
66 V A -1.6144
67 D A -2.7610
68 Y A 0.0000
69 T A -0.9191
70 I A 0.0000
71 T A -0.0633
72 V A 0.0000
73 Y A 0.7350
74 A A 0.0000
75 M A 1.9817
76 Y A 2.1552
77 Y A 1.6296
78 Y A 0.6920
79 Q A -1.5837
80 E A -2.3724
81 E A -1.6881
82 Y A 1.1086
83 M A 1.6323
84 Y A 2.2208
85 S A 0.0000
86 S A 0.2709
87 P A 0.1625
88 I A 0.0963
89 S A -0.4829
90 I A -0.5804
91 N A -1.8226
92 Y A -1.6066
93 R A -2.7445
94 T A -1.5487
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018