Project name: obj1 [mutate: SA119C, TN114C, QA112C, YQ109C, GE111C, VI116C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	YQ109C,SA119C,VI116C,TN114C,QA112C,GE111C
Energy difference between WT (input) and mutated protein (by FoldX)	26.9624 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:54)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:28)

• Minimal score value: -3.3421
• Maximal score value: 1.6654
• Average score: -0.6344
• Total score value: -76.1221

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.1213
2	V	C	-1.1151
3	Q	C	-1.1067
4	L	C	0.0000
5	V	C	1.5210
6	E	C	0.0000
7	S	C	-0.0817
8	G	C	-0.8287
9	G	C	-0.0524
10	G	C	0.8289
11	L	C	1.4296
12	V	C	-0.0543
13	Q	C	-1.2994
14	P	C	-1.4529
15	G	C	-1.4128
16	G	C	-0.9720
17	S	C	-1.2376
18	L	C	-0.9668
19	R	C	-2.1390
20	L	C	0.0000
21	S	C	-0.4108
22	C	C	0.0000
23	A	C	0.0578
24	A	C	0.0000
25	S	C	-0.1286
26	D	C	0.0000
27	F	C	1.5425
28	T	C	0.2496
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1450
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.3109
40	A	C	-0.9950
41	P	C	-1.2935
42	G	C	-1.4368
43	K	C	-2.1454
44	G	C	-1.0790
45	L	C	0.3538
46	E	C	-0.4412
47	W	C	0.3145
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5829
53	G	C	-1.2446
54	S	C	-1.2285
55	G	C	-1.0815
56	G	C	-0.7342
57	S	C	-0.3020
58	T	C	0.1991
59	Y	C	0.6078
60	Y	C	-0.3572
61	A	C	-1.1461
62	D	C	-2.3472
63	S	C	-1.7211
64	V	C	0.0000
65	K	C	-2.3863
66	G	C	-1.6183
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6722
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6475
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6448
81	L	C	0.0000
82	Q	C	-1.2319
83	M	C	0.0000
84	N	C	-1.3296
85	S	C	-1.2272
86	L	C	0.0000
87	R	C	-2.4483
88	A	C	-1.8439
89	E	C	-2.3248
90	D	C	0.0000
91	T	C	-0.4076
92	A	C	0.0000
93	I	C	1.1434
94	Y	C	0.0000
95	Y	C	0.9802
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.3168
101	D	C	-3.3421
102	G	C	-2.0859
103	F	C	-1.2302
104	N	C	-2.4276
105	K	C	-3.1917
106	G	C	-1.9876
107	F	C	-1.2243
108	D	C	-1.5122
109	Q	C	-0.9441	mutated: YQ109C
110	W	C	0.5087
111	E	C	0.0000	mutated: GE111C
112	A	C	0.5245	mutated: QA112C
113	G	C	0.7850
114	N	C	0.7585	mutated: TN114C
115	L	C	1.6654
116	I	C	0.0000	mutated: VI116C
117	T	C	0.3476
118	V	C	0.0000
119	A	C	-0.6063	mutated: SA119C
120	S	C	-0.9794