Project name: query_structure

Status: done

Started: 2026-03-16 19:58:06
Settings
Chain sequence(s) A: CGPGRFQCESGQCVPATWVCDGDDDCADGSDEKSCATTAPTCESNQFQCGSGQCLPGTWRCDGVNDCADSSDETGCGRPGPGATSAPAACGPGRFQCNNGNCVPQTLGCDGDNDCGDSSDEANCSAPASEPPGSL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:19)
Show buried residues

Minimal score value
-3.6246
Maximal score value
1.2979
Average score
-1.3425
Total score value
-181.234

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 C A -0.4054
2 G A -0.8596
3 P A -0.9506
4 G A -1.3648
5 R A -1.7450
6 F A -1.0840
7 Q A -1.9428
8 C A 0.0000
9 E A -2.7948
10 S A -1.9331
11 G A -1.7502
12 Q A -1.7999
13 C A -1.1231
14 V A 0.0000
15 P A -0.5711
16 A A -0.6597
17 T A -0.2522
18 W A -0.7126
19 V A -1.0975
20 C A -1.6761
21 D A -2.6347
22 G A -2.5883
23 D A -3.5023
24 D A -3.6246
25 D A -2.3180
26 C A 0.0000
27 A A -1.3902
28 D A -2.1499
29 G A 0.0000
30 S A 0.0000
31 D A 0.0000
32 E A -2.3901
33 K A -2.3384
34 S A -0.9108
35 C A -0.5525
36 A A -0.2284
37 T A -0.0120
38 T A -0.2108
39 A A -0.4478
40 P A -1.1622
41 T A -1.0018
42 C A -1.5839
43 E A -2.5661
44 S A -1.8375
45 N A -2.2871
46 Q A -2.0962
47 F A -1.4240
48 Q A -1.6708
49 C A 0.0000
50 G A -1.2606
51 S A -1.2797
52 G A -1.3034
53 Q A -1.4004
54 C A -1.0684
55 L A 0.0000
56 P A -1.1612
57 G A -1.6172
58 T A -1.0428
59 W A -0.9746
60 R A -2.2132
61 C A -1.8377
62 D A -2.2111
63 G A -1.1172
64 V A 0.0590
65 N A -1.3924
66 D A -1.3022
67 C A 0.0000
68 A A -1.1445
69 D A -1.7126
70 S A -1.2185
71 S A -1.4820
72 D A 0.0000
73 E A -1.2947
74 T A -0.9828
75 G A -1.0599
76 C A -1.4547
77 G A -1.5158
78 R A -2.3160
79 P A -1.5320
80 G A -1.4474
81 P A -1.1110
82 G A -1.3438
83 A A -1.4175
84 T A -0.6050
85 S A -0.4993
86 A A -0.1937
87 P A -0.7495
88 A A -0.9851
89 A A -0.8097
90 C A -1.5864
91 G A -1.3777
92 P A -1.3084
93 G A -2.0813
94 R A -2.9609
95 F A -2.1722
96 Q A -2.6328
97 C A 0.0000
98 N A -2.7573
99 N A -2.9284
100 G A -2.2622
101 N A -2.7036
102 C A -1.9223
103 V A 0.0000
104 P A -1.7110
105 Q A -2.2963
106 T A -1.0825
107 L A -1.5328
108 G A -1.8367
109 C A -1.4589
110 D A -2.2773
111 G A -2.2736
112 D A -3.3265
113 N A -3.2819
114 D A -2.6511
115 C A 0.0000
116 G A -2.2939
117 D A -2.3383
118 S A -2.3563
119 S A -2.1076
120 D A 0.0000
121 E A -1.8492
122 A A -0.9755
123 N A -1.2246
124 C A -0.6187
125 S A -0.4450
126 A A -0.5482
127 P A -0.6212
128 A A -0.6709
129 S A -1.3098
130 E A -2.2212
131 P A -1.4631
132 P A -0.9862
133 G A -0.6640
134 S A 0.2334
135 L A 1.2979
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018