Project name: Blg

Chain sequence(s)	A: QTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:49)

• Minimal score value: -4.2111
• Maximal score value: 0.3465
• Average score: -1.1616
• Total score value: -181.215

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
5	Q	A	-1.3743
6	T	A	-0.9301
7	M	A	-1.1685
8	K	A	-2.0663
9	G	A	-1.3645
10	L	A	0.0000
11	D	A	-1.8077
12	I	A	-1.8621
13	Q	A	-2.5571
14	K	A	-2.7428
15	V	A	0.0000
16	A	A	-1.2550
17	G	A	-0.9362
18	T	A	-0.4999
19	W	A	0.0000
20	Y	A	-0.3736
21	S	A	0.0000
22	L	A	0.0000
23	A	A	0.0000
24	M	A	0.0000
25	A	A	0.0000
26	A	A	0.0000
27	S	A	0.0000
28	D	A	-0.7800
29	I	A	0.3465
30	S	A	-0.4466
31	L	A	-0.4444
32	L	A	0.0000
33	D	A	-1.6072
34	A	A	-1.0111
35	Q	A	-1.1677
36	S	A	-1.3861
37	A	A	0.0000
38	P	A	-0.8977
39	L	A	0.0000
40	R	A	-0.7043
41	V	A	0.0000
42	Y	A	0.0000
43	V	A	0.0000
44	E	A	-0.9528
45	E	A	-1.0009
46	L	A	0.0000
47	K	A	-1.2465
48	P	A	-1.5020
49	T	A	-1.3336
50	P	A	-1.5178
51	E	A	-2.5727
52	G	A	-2.2152
53	D	A	-2.1495
54	L	A	0.0000
55	E	A	-0.6304
56	I	A	0.0000
57	L	A	-1.0419
58	L	A	0.0000
59	Q	A	0.0000
60	K	A	0.0000
61	W	A	-1.8611
62	E	A	-3.0745
63	N	A	-2.8431
64	G	A	-2.3227
65	E	A	-3.0005
66	C	A	-2.0920
67	A	A	-1.8716
68	Q	A	-2.2604
69	K	A	-1.6820
70	K	A	-1.8194
71	I	A	0.0000
72	I	A	0.2537
73	A	A	0.0000
74	E	A	-2.9771
75	K	A	-2.8602
76	T	A	-1.9684
77	K	A	-1.6474
78	I	A	-0.6692
79	P	A	-1.0522
80	A	A	0.0000
81	V	A	0.0000
82	F	A	0.0000
83	K	A	-2.4404
84	I	A	0.0000
85	D	A	-2.3281
86	A	A	-1.3510
87	L	A	-0.7756
88	N	A	-1.7459
89	E	A	0.0000
90	N	A	-2.0306
91	K	A	-1.8586
92	V	A	0.0000
93	L	A	-0.2220
94	V	A	0.0000
95	L	A	-0.6100
96	D	A	-0.9810
97	T	A	0.0000
98	D	A	-1.3624
99	Y	A	-1.8722
100	K	A	-2.5435
101	K	A	-2.2769
102	Y	A	0.0000
103	L	A	0.0000
104	L	A	0.0000
105	F	A	0.0000
106	C	A	0.0000
107	M	A	0.0000
108	E	A	-1.5895
109	N	A	-2.2818
110	S	A	-1.3723
111	A	A	-1.4854
112	E	A	-2.9141
113	P	A	-2.5172
114	E	A	-3.1115
115	Q	A	-2.6214
116	S	A	0.0000
117	L	A	0.0000
118	V	A	0.0000
119	C	A	0.0000
120	Q	A	0.0000
121	C	A	0.0000
122	L	A	0.0000
123	V	A	0.0000
124	R	A	-1.3123
125	T	A	-1.2778
126	P	A	-1.7775
127	E	A	-2.2693
128	V	A	-1.3017
129	D	A	-2.2988
130	D	A	-3.3912
131	E	A	-3.7502
132	A	A	0.0000
133	L	A	-2.7699
134	E	A	-4.2111
135	K	A	-3.6020
136	F	A	0.0000
137	D	A	-3.7349
138	K	A	-3.5886
139	A	A	-2.3001
140	L	A	0.0000
141	K	A	-2.5457
142	A	A	-0.9481
143	L	A	-0.4353
144	P	A	-0.7861
145	M	A	-0.6315
146	H	A	-0.6133
147	I	A	-0.4732
148	R	A	-0.9773
149	L	A	-0.2782
150	S	A	-0.2832
151	F	A	-0.6139
152	N	A	-1.8371
153	P	A	-1.9813
154	T	A	-1.9122
155	Q	A	-2.2543
156	L	A	0.0000
157	E	A	-3.5310
158	E	A	-3.4484
159	Q	A	-2.8400
160	C	A	0.0000