Project name: query_structure

Status: done

Started: 2026-03-17 00:48:02
Settings
Chain sequence(s) A: QVQLVESGGGLVQAGGSLRLSCAASGFPVYQKYMEWYRQAPGKEREWVAAIESNGWWTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNVKDYGNNWQYYDYWGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:27)
Show buried residues

Minimal score value
-3.374
Maximal score value
1.5765
Average score
-0.6394
Total score value
-76.733

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.2964
2 V A -0.4761
3 Q A -0.7065
4 L A 0.0000
5 V A 1.1105
6 E A 0.0000
7 S A -0.5776
8 G A -1.0428
9 G A -0.7907
10 G A -0.0139
11 L A 1.0307
12 V A 0.0250
13 Q A -1.2213
14 A A -1.4173
15 G A -1.3403
16 G A -0.8865
17 S A -1.2221
18 L A -0.9232
19 R A -2.1415
20 L A 0.0000
21 S A -0.3750
22 C A 0.0000
23 A A -0.0814
24 A A 0.0000
25 S A -0.5355
26 G A -0.8188
27 F A -0.3866
28 P A -0.6215
29 V A 0.0000
30 Y A -0.2865
31 Q A -1.1571
32 K A -0.7003
33 Y A -0.1918
34 M A 0.0000
35 E A 0.0076
36 W A 0.0000
37 Y A -0.2838
38 R A -1.0701
39 Q A -1.9445
40 A A -1.9710
41 P A -1.4036
42 G A -1.9382
43 K A -3.2891
44 E A -3.3740
45 R A -2.3629
46 E A -1.5571
47 W A -0.4127
48 V A 0.0000
49 A A 0.0000
50 A A 0.4611
51 I A 0.0000
52 E A -0.0612
53 S A -0.5237
54 N A -0.8055
55 G A -0.1562
56 W A 1.1700
57 W A 1.5765
58 T A 1.1602
59 Y A 0.6783
60 Y A -0.4751
61 A A -1.1298
62 D A -2.3231
63 S A -1.7673
64 V A 0.0000
65 K A -2.5157
66 G A -1.8005
67 R A -1.5164
68 F A 0.0000
69 T A -0.7667
70 I A 0.0000
71 S A -0.4819
72 R A -1.2074
73 D A -1.7764
74 N A -2.0844
75 A A -1.5631
76 K A -2.4646
77 N A -1.5854
78 T A 0.0000
79 V A 0.0000
80 Y A -0.6999
81 L A 0.0000
82 Q A -1.2423
83 M A 0.0000
84 N A -1.4625
85 S A -1.2399
86 L A 0.0000
87 K A -2.3122
88 P A -1.9081
89 E A -2.3379
90 D A 0.0000
91 T A -0.9471
92 A A 0.0000
93 V A -0.4508
94 Y A 0.0000
95 Y A -0.0896
96 C A 0.0000
97 N A 0.0000
98 V A 0.0000
99 K A -0.6625
100 D A -0.2892
101 Y A 0.2802
102 G A -0.4242
103 N A -1.5524
104 N A -1.3824
105 W A 0.3119
106 Q A -0.4071
107 Y A 0.8260
108 Y A 0.6321
109 D A -1.0198
110 Y A -0.1973
111 W A 0.0511
112 G A 0.0801
113 Q A -0.8993
114 G A 0.0000
115 T A -0.6593
116 Q A -1.1220
117 V A 0.0000
118 T A -0.2657
119 V A 0.0000
120 S A -0.7407
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018