Project name: 9C2Fv [mutate: TA51B]

Status: done

Started: 2026-06-15 07:32:52
Settings
Chain sequence(s) A: EVQLVQSGGGFVQPGGSLRLSCAVSGFTFSSYAMSWVRQAPGRGLEWVSTISGSGGGTFYADSVKGRFTISRDNSKNTLFLQMNSLRVEDTAVYYCTRDYWGGMDVWGKGTTVTVSS
B: DIVMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYATSTLQSGVPSRFSGSGSGPDFTLTISGLQPEDFATYYCQQADSFPLTFGGGTKVEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues TA51B
Energy difference between WT (input) and mutated protein (by FoldX) 1.35809 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:46)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:47)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:22)
Show buried residues

Minimal score value
-2.6444
Maximal score value
1.5952
Average score
-0.475
Total score value
-106.3924

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.1372
2 V A -1.1015
3 Q A -1.3059
4 L A 0.0000
5 V A 1.1073
6 Q A 0.0000
7 S A -0.3974
8 G A -0.9857
9 G A -0.2787
10 G A 0.4885
11 F A 1.5952
12 V A 0.3810
13 Q A -0.9839
14 P A -1.1063
15 G A -1.2036
16 G A -0.9050
17 S A -1.0055
18 L A -0.8406
19 R A -2.1080
20 L A 0.0000
21 S A -0.2904
22 C A 0.0000
23 A A -0.1044
24 V A 0.0000
25 S A -1.0894
26 G A -1.2551
27 F A -0.4983
28 T A -0.2454
29 F A 0.0000
30 S A -0.6087
31 S A -0.2653
32 Y A 0.1416
33 A A -0.0964
34 M A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.8782
40 A A -1.2503
41 P A -1.0429
42 G A -1.5770
43 R A -2.4346
44 G A -1.5238
45 L A 0.0000
46 E A -1.1055
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 T A 0.0000
51 I A 0.0000
52 S A -0.3433
53 G A -0.5108
54 S A -0.6992
55 G A -0.7618
56 G A -0.7064
57 G A -0.3239
58 T A 0.1021
59 F A 0.4989
60 Y A -0.3558
61 A A 0.0000
62 D A -2.3567
63 S A -1.6840
64 V A 0.0000
65 K A -2.4196
66 G A -1.6373
67 R A 0.0000
68 F A 0.0000
69 T A -0.7277
70 I A 0.0000
71 S A -0.4373
72 R A -0.9777
73 D A -1.5262
74 N A -1.7441
75 S A -1.6162
76 K A -2.4278
77 N A -1.8753
78 T A 0.0000
79 L A 0.0000
80 F A -0.4626
81 L A 0.0000
82 Q A -1.2651
83 M A 0.0000
84 N A -1.3344
85 S A -1.1911
86 L A 0.0000
87 R A -1.3938
88 V A 0.0026
89 E A -1.3823
90 D A 0.0000
91 T A -0.0550
92 A A 0.0000
93 V A 0.0473
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 T A 0.0000
98 R A 0.0000
99 D A 0.1965
100 Y A 0.8092
101 W A 1.3810
102 G A 0.5577
103 G A 0.0000
104 M A 0.0000
105 D A -0.1719
106 V A -0.3150
107 W A -0.4152
108 G A 0.0000
109 K A -1.7793
110 G A 0.0000
111 T A -0.2558
112 T A 0.2177
113 V A 0.0000
114 T A 0.4670
115 V A 0.0000
116 S A -0.1788
117 S A -0.2559
1 D B -1.3040
2 I B 0.0000
3 V B 0.7274
4 M B 0.0000
5 T B -0.5009
6 Q B -0.6342
7 S B -0.7984
8 P B -0.6075
9 S B -0.8555
10 S B -1.0985
11 V B -0.5702
12 S B -0.7950
13 A B 0.0000
14 S B -0.2082
15 V B 0.5709
16 G B -0.7121
17 D B -1.5930
18 R B -2.3059
19 V B 0.0000
20 T B -0.6155
21 I B 0.0000
22 T B -0.7618
23 C B 0.0000
24 R B -2.0379
25 A B 0.0000
26 S B -1.0275
27 Q B -1.8035
28 G B -1.6184
29 I B 0.0000
30 S B -0.3997
31 S B -0.3089
32 W B 0.4938
33 L B 0.0000
34 A B 0.0000
35 W B 0.0000
36 Y B 0.0000
37 Q B 0.0000
38 Q B 0.0000
39 K B -1.6629
40 P B -1.2404
41 G B -1.6573
42 K B -2.6444
43 A B -1.7564
44 P B 0.0000
45 K B -1.5443
46 L B 0.0000
47 L B 0.0000
48 I B 0.0000
49 Y B 0.5362
50 A B 0.5022
51 A B 0.0000 mutated: TA51B
52 S B -0.2084
53 T B 0.0453
54 L B 0.1450
55 Q B -0.3795
56 S B -0.4705
57 G B -0.5978
58 V B 0.0000
59 P B -0.4458
60 S B -0.4907
61 R B -0.8054
62 F B 0.0000
63 S B -0.3349
64 G B 0.0000
65 S B -0.6934
66 G B -1.1277
67 S B -1.0759
68 G B -1.2621
69 P B -1.7523
70 D B -1.8745
71 F B 0.0000
72 T B -0.7096
73 L B 0.0000
74 T B -0.6191
75 I B 0.0000
76 S B -1.4102
77 G B -1.1287
78 L B 0.0000
79 Q B -1.0839
80 P B -0.7936
81 E B -1.8824
82 D B 0.0000
83 F B -0.6150
84 A B 0.0000
85 T B 0.0000
86 Y B 0.0000
87 Y B 0.0000
88 C B 0.0000
89 Q B 0.0000
90 Q B 0.0000
91 A B 0.2284
92 D B -0.3488
93 S B -0.0415
94 F B 0.8571
95 P B 0.0673
96 L B 0.0000
97 T B 0.0882
98 F B 0.1343
99 G B 0.0000
100 G B -0.9521
101 G B -1.0801
102 T B 0.0000
103 K B -1.9484
104 V B 0.0000
105 E B -1.1908
106 I B 0.6374
107 K B -0.8218
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018