Project name: Mb5-11_LVFILL

Status: done

Started: 2026-07-06 06:34:21
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQLSWDAFHRYHNGFTHPVRYYRVTYGETGGNSPVQEFTVPGSKSTATFSGLKPGVDYTITVYAVTWYPRYGYGESGPLSLNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:53)
Show buried residues

Minimal score value
-2.813
Maximal score value
1.4474
Average score
-0.7452
Total score value
-81.2319

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.4044
2 Q A -0.8384
3 A A -0.7220
4 N A -1.3053
5 S A -0.9302
6 G A 0.0000
7 S A -1.0847
8 L A -0.9530
9 E A -1.8912
10 V A -0.8298
11 V A -0.1910
12 E A -1.5720
13 A A -1.3394
14 S A -1.6047
15 P A -2.0108
16 T A -1.2565
17 S A -1.1942
18 L A 0.0000
19 Q A -1.0361
20 L A 0.0000
21 S A -1.1020
22 W A 0.0000
23 D A -1.9728
24 A A -1.3225
25 F A 0.0000
26 H A -1.0825
27 R A -0.2862
28 Y A 0.8812
29 H A 0.1369
30 N A -0.6328
31 G A 0.0880
32 F A 1.4474
33 T A 0.6874
34 H A 0.0491
35 P A -0.4103
36 V A -1.0166
37 R A -1.3544
38 Y A -0.8430
39 Y A 0.0000
40 R A -0.7983
41 V A 0.0000
42 T A -0.7199
43 Y A 0.0000
44 G A -0.6978
45 E A -1.4052
46 T A -1.1376
47 G A -1.1647
48 G A -1.2761
49 N A -1.5178
50 S A -0.9052
51 P A -0.4141
52 V A 0.2664
53 Q A -1.2783
54 E A -1.8982
55 F A -0.8008
56 T A -0.2171
57 V A -0.4099
58 P A -0.9056
59 G A -1.2137
60 S A -1.2070
61 K A -1.6324
62 S A -1.0963
63 T A -0.8370
64 A A 0.0000
65 T A -0.4068
66 F A 0.0000
67 S A -0.7674
68 G A -0.9797
69 L A 0.0000
70 K A -2.4263
71 P A -2.1518
72 G A -1.4842
73 V A -1.2952
74 D A -2.0972
75 Y A 0.0000
76 T A -0.7877
77 I A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.2426
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.6380
85 Y A 0.0000
86 P A -0.4547
87 R A -1.1234
88 Y A 0.6636
89 G A 0.5994
90 Y A 0.8985
91 G A 0.2325
92 E A -0.6883
93 S A 0.0000
94 G A -0.6346
95 P A -0.3978
96 L A -0.2991
97 S A -0.5237
98 L A -0.6693
99 N A -1.7395
100 Y A -1.6233
101 R A -2.5896
102 T A 0.0000
103 E A -2.5514
104 L A -1.3362
105 D A -2.7506
106 K A -2.8130
107 P A -1.7832
108 S A -1.6339
109 Q A -1.6588
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018