Chain sequence(s) |
A: SRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDVNGWARNTPAFEWYYQSGLSIVMPVGGQSSFYSDWLKPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPAFIDAAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
input PDB |
Selected Chain(s) | A |
Distance of aggregation | 10 Å |
FoldX usage | Yes |
Dynamic mode | No |
Automated mutations | Yes |
Downloads | Download all the data |
Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:00) [WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow to prevent this behavior) (00:00:00) [INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:00) [INFO] runJob: Creating pdb object from: input.pdb (00:00:00) [INFO] FoldX: Starting FoldX energy minimalization (00:00:00) [INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:03:53) [INFO] Auto_mut: Residue number 228 from chain A and a score of 2.019 (phenylalanine) selected for automated muatation (00:03:55) [INFO] Auto_mut: Residue number 224 from chain A and a score of 1.774 (isoleucine) selected for automated muatation (00:03:55) [INFO] Auto_mut: Residue number 256 from chain A and a score of 1.397 (phenylalanine) selected for automated muatation (00:03:55) [INFO] Auto_mut: Residue number 229 from chain A and a score of 1.395 (leucine) selected for automated muatation (00:03:55) [INFO] Auto_mut: Residue number 254 from chain A and a score of 1.356 (phenylalanine) selected for automated muatation (00:03:55) [INFO] Auto_mut: Residue number 253 from chain A and a score of 1.037 (valine) selected for automated muatation (00:03:55) [INFO] Auto_mut: Mutating residue number 224 from chain A (isoleucine) into glutamic acid (00:03:55) [INFO] Auto_mut: Mutating residue number 228 from chain A (phenylalanine) into aspartic acid Mutating residue number 228 from chain A (phenylalanine) into aspartic acid (00:03:55) [INFO] Auto_mut: Mutating residue number 228 from chain A (phenylalanine) into glutamic acid Mutating residue number 228 from chain A (phenylalanine) into glutamic acid (00:03:55) [INFO] Auto_mut: Mutating residue number 224 from chain A (isoleucine) into lysine (00:05:02) [INFO] Auto_mut: Mutating residue number 228 from chain A (phenylalanine) into arginine (00:05:02) [INFO] Auto_mut: Mutating residue number 228 from chain A (phenylalanine) into lysine (00:05:07) [INFO] Auto_mut: Mutating residue number 224 from chain A (isoleucine) into aspartic acid (00:06:15) [INFO] Auto_mut: Mutating residue number 256 from chain A (phenylalanine) into glutamic acid Mutating residue number 256 from chain A (phenylalanine) into glutamic acid (00:06:27) [INFO] Auto_mut: Mutating residue number 256 from chain A (phenylalanine) into aspartic acid Mutating residue number 256 from chain A (phenylalanine) into aspartic acid (00:06:34) [INFO] Auto_mut: Mutating residue number 224 from chain A (isoleucine) into arginine (00:07:22) [INFO] Auto_mut: Mutating residue number 256 from chain A (phenylalanine) into lysine (00:07:32) [INFO] Auto_mut: Mutating residue number 256 from chain A (phenylalanine) into arginine (00:07:40) [INFO] Auto_mut: Mutating residue number 229 from chain A (leucine) into glutamic acid (00:08:32) [INFO] Auto_mut: Mutating residue number 229 from chain A (leucine) into aspartic acid (00:08:45) [INFO] Auto_mut: Mutating residue number 254 from chain A (phenylalanine) into glutamic acid Mutating residue number 254 from chain A (phenylalanine) into glutamic acid (00:08:50) [INFO] Auto_mut: Mutating residue number 229 from chain A (leucine) into lysine (00:09:44) [INFO] Auto_mut: Mutating residue number 229 from chain A (leucine) into arginine (00:09:52) [INFO] Auto_mut: Mutating residue number 254 from chain A (phenylalanine) into lysine (00:09:56) [INFO] Auto_mut: Mutating residue number 254 from chain A (phenylalanine) into aspartic acid Mutating residue number 254 from chain A (phenylalanine) into aspartic acid (00:11:03) [INFO] Auto_mut: Mutating residue number 253 from chain A (valine) into glutamic acid (00:11:10) [INFO] Auto_mut: Mutating residue number 253 from chain A (valine) into aspartic acid (00:11:15) [INFO] Auto_mut: Mutating residue number 254 from chain A (phenylalanine) into arginine (00:12:12) [INFO] Auto_mut: Mutating residue number 253 from chain A (valine) into lysine (00:12:20) [INFO] Auto_mut: Mutating residue number 253 from chain A (valine) into arginine (00:12:25) [INFO] Auto_mut: Effect of mutation residue number 228 from chain A (phenylalanine) into glutamic acid: Energy difference: 0.1087 kcal/mol, Difference in average score from the base case: -0.0251 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 228 from chain A (phenylalanine) into lysine: Energy difference: -0.2356 kcal/mol, Difference in average score from the base case: -0.0247 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 228 from chain A (phenylalanine) into aspartic acid: Energy difference: 0.5538 kcal/mol, Difference in average score from the base case: -0.0250 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 228 from chain A (phenylalanine) into arginine: Energy difference: -0.1644 kcal/mol, Difference in average score from the base case: -0.0260 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 224 from chain A (isoleucine) into glutamic acid: Energy difference: -1.0452 kcal/mol, Difference in average score from the base case: -0.0224 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 224 from chain A (isoleucine) into lysine: Energy difference: -0.3859 kcal/mol, Difference in average score from the base case: -0.0244 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 224 from chain A (isoleucine) into aspartic acid: Energy difference: -0.0769 kcal/mol, Difference in average score from the base case: -0.0241 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 224 from chain A (isoleucine) into arginine: Energy difference: -0.4653 kcal/mol, Difference in average score from the base case: -0.0324 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 256 from chain A (phenylalanine) into glutamic acid: Energy difference: -1.7364 kcal/mol, Difference in average score from the base case: 0.0005 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 256 from chain A (phenylalanine) into lysine: Energy difference: 0.3382 kcal/mol, Difference in average score from the base case: 0.0012 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 256 from chain A (phenylalanine) into aspartic acid: Energy difference: -0.7424 kcal/mol, Difference in average score from the base case: 0.0031 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 256 from chain A (phenylalanine) into arginine: Energy difference: -0.0800 kcal/mol, Difference in average score from the base case: -0.0115 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 229 from chain A (leucine) into glutamic acid: Energy difference: 1.4253 kcal/mol, Difference in average score from the base case: -0.0022 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 229 from chain A (leucine) into lysine: Energy difference: 0.4786 kcal/mol, Difference in average score from the base case: -0.0019 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 229 from chain A (leucine) into aspartic acid: Energy difference: 1.8011 kcal/mol, Difference in average score from the base case: -0.0013 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 229 from chain A (leucine) into arginine: Energy difference: -0.2554 kcal/mol, Difference in average score from the base case: 0.0008 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 254 from chain A (phenylalanine) into glutamic acid: Energy difference: 1.5592 kcal/mol, Difference in average score from the base case: 0.0057 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 254 from chain A (phenylalanine) into lysine: Energy difference: 1.0055 kcal/mol, Difference in average score from the base case: 0.0013 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 254 from chain A (phenylalanine) into aspartic acid: Energy difference: 1.6385 kcal/mol, Difference in average score from the base case: -0.0110 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 254 from chain A (phenylalanine) into arginine: Energy difference: 1.0873 kcal/mol, Difference in average score from the base case: -0.0070 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 253 from chain A (valine) into glutamic acid: Energy difference: -0.2021 kcal/mol, Difference in average score from the base case: -0.0031 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 253 from chain A (valine) into lysine: Energy difference: -0.7666 kcal/mol, Difference in average score from the base case: -0.0019 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 253 from chain A (valine) into aspartic acid: Energy difference: -0.1266 kcal/mol, Difference in average score from the base case: -0.0002 (00:14:08) [INFO] Auto_mut: Effect of mutation residue number 253 from chain A (valine) into arginine: Energy difference: -0.5169 kcal/mol, Difference in average score from the base case: -0.0076 (00:14:08) [INFO] Main: Simulation completed successfully. (00:14:15) |
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
residue index | residue name | chain | Aggrescan3D score | mutation |
---|---|---|---|---|
residue index | residue name | chain | Aggrescan3D score | |
2 | S | A | -1.2859 | |
3 | R | A | -2.1430 | |
4 | P | A | -1.3685 | |
5 | G | A | -1.0101 | |
6 | L | A | -0.5424 | |
7 | P | A | -0.1037 | |
8 | V | A | 0.1525 | |
9 | E | A | -0.2295 | |
10 | Y | A | 0.0999 | |
11 | L | A | 0.0000 | |
12 | Q | A | -1.3762 | |
13 | V | A | 0.0000 | |
14 | P | A | -1.2938 | |
15 | S | A | 0.0000 | |
16 | P | A | -0.9410 | |
17 | S | A | -0.7049 | |
18 | M | A | 0.0000 | |
19 | G | A | -1.3357 | |
20 | R | A | -1.8551 | |
21 | D | A | -2.1562 | |
22 | I | A | 0.0000 | |
23 | K | A | -1.4803 | |
24 | V | A | 0.0000 | |
25 | Q | A | -0.1797 | |
26 | F | A | 0.0000 | |
27 | Q | A | 0.0000 | |
28 | S | A | -0.8029 | |
29 | G | A | -1.1326 | |
30 | G | A | -1.5884 | |
31 | N | A | -2.3561 | |
32 | N | A | -2.5036 | |
33 | S | A | 0.0000 | |
34 | P | A | 0.0000 | |
35 | A | A | 0.0000 | |
36 | V | A | 0.0000 | |
37 | Y | A | 0.0000 | |
38 | L | A | 0.0000 | |
39 | L | A | 0.0000 | |
40 | D | A | 0.0000 | |
41 | G | A | -0.6789 | |
42 | L | A | -1.1513 | |
43 | R | A | -2.5608 | |
44 | A | A | 0.0000 | |
45 | Q | A | -2.5994 | |
46 | D | A | -3.2321 | |
47 | D | A | -2.6252 | |
48 | V | A | -1.4163 | |
49 | N | A | 0.0000 | |
50 | G | A | 0.0000 | |
51 | W | A | 0.0000 | |
52 | A | A | 0.0000 | |
53 | R | A | -1.9106 | |
54 | N | A | -1.4624 | |
55 | T | A | 0.0000 | |
56 | P | A | -0.9798 | |
57 | A | A | 0.0000 | |
58 | F | A | 0.0000 | |
59 | E | A | -0.7290 | |
60 | W | A | -0.2986 | |
61 | Y | A | 0.0000 | |
62 | Y | A | -0.0691 | |
63 | Q | A | -1.0897 | |
64 | S | A | 0.0000 | |
65 | G | A | -1.0224 | |
66 | L | A | 0.0000 | |
67 | S | A | 0.0000 | |
68 | I | A | 0.0000 | |
69 | V | A | 0.0000 | |
70 | M | A | 0.0000 | |
71 | P | A | 0.0000 | |
72 | V | A | 0.0000 | |
73 | G | A | -1.8023 | |
74 | G | A | -1.1663 | |
75 | Q | A | -1.5753 | |
76 | S | A | 0.0000 | |
77 | S | A | 0.0000 | |
78 | F | A | 0.0000 | |
79 | Y | A | 0.0000 | |
80 | S | A | 0.0000 | |
81 | D | A | -0.6809 | |
82 | W | A | 0.0000 | |
83 | L | A | -0.0369 | |
84 | K | A | -1.6954 | |
85 | P | A | -1.1079 | |
86 | A | A | 0.0000 | |
87 | C | A | -0.5558 | |
88 | G | A | -1.1007 | |
89 | K | A | -1.8149 | |
90 | A | A | -0.7905 | |
91 | G | A | -0.4599 | |
92 | C | A | 0.1530 | |
93 | Q | A | -0.7057 | |
94 | T | A | -0.7518 | |
95 | Y | A | 0.0000 | |
96 | K | A | -0.8446 | |
97 | W | A | 0.0000 | |
98 | E | A | 0.0000 | |
99 | T | A | -0.4284 | |
100 | F | A | 0.0000 | |
101 | L | A | 0.0000 | |
102 | T | A | -0.3975 | |
103 | S | A | -0.6525 | |
104 | E | A | -0.8115 | |
105 | L | A | 0.0000 | |
106 | P | A | 0.0000 | |
107 | Q | A | -1.4868 | |
108 | W | A | -0.6051 | |
109 | L | A | 0.0000 | |
110 | S | A | -1.3893 | |
111 | A | A | -0.7798 | |
112 | N | A | -1.0332 | |
113 | R | A | -1.5641 | |
114 | A | A | -1.7452 | |
115 | V | A | 0.0000 | |
116 | K | A | -2.2054 | |
117 | P | A | -1.3574 | |
118 | T | A | -1.0166 | |
119 | G | A | -0.6424 | |
120 | S | A | 0.0000 | |
121 | A | A | 0.0000 | |
122 | A | A | 0.0000 | |
123 | I | A | 0.0000 | |
124 | G | A | 0.0000 | |
125 | L | A | 0.0000 | |
126 | S | A | -0.0854 | |
127 | M | A | -0.1050 | |
128 | A | A | 0.0000 | |
129 | G | A | 0.0000 | |
130 | S | A | 0.0000 | |
131 | S | A | 0.0000 | |
132 | A | A | 0.0000 | |
133 | M | A | 0.0000 | |
134 | I | A | 0.0000 | |
135 | L | A | 0.0000 | |
136 | A | A | 0.0000 | |
137 | A | A | 0.0000 | |
138 | Y | A | -0.1419 | |
139 | H | A | -0.5317 | |
140 | P | A | -0.9914 | |
141 | Q | A | -1.3911 | |
142 | Q | A | -0.9901 | |
143 | F | A | 0.0000 | |
144 | I | A | -0.4516 | |
145 | Y | A | 0.0000 | |
146 | A | A | 0.0000 | |
147 | G | A | 0.0000 | |
148 | S | A | 0.0000 | |
149 | L | A | 0.0000 | |
150 | S | A | 0.0000 | |
151 | A | A | 0.0000 | |
152 | L | A | 0.2807 | |
153 | L | A | 0.0000 | |
154 | D | A | -1.1254 | |
155 | P | A | 0.0000 | |
156 | S | A | -1.3203 | |
157 | Q | A | -1.5535 | |
158 | G | A | -0.5506 | |
159 | M | A | 0.5333 | |
160 | G | A | -0.0083 | |
161 | P | A | -0.2640 | |
162 | A | A | 0.1023 | |
163 | F | A | 0.6064 | |
164 | I | A | 0.0000 | |
165 | D | A | -1.3186 | |
166 | A | A | -0.9407 | |
167 | A | A | -1.1439 | |
168 | M | A | 0.0000 | |
169 | G | A | -1.8862 | |
170 | D | A | -2.5631 | |
171 | A | A | 0.0000 | |
172 | G | A | -1.7322 | |
173 | G | A | -1.7682 | |
174 | Y | A | 0.0000 | |
175 | K | A | -2.4080 | |
176 | A | A | 0.0000 | |
177 | A | A | -1.1416 | |
178 | D | A | -1.2130 | |
179 | M | A | 0.0000 | |
180 | W | A | 0.0000 | |
181 | G | A | 0.0000 | |
182 | P | A | -0.8348 | |
183 | S | A | -0.9767 | |
184 | S | A | -0.8622 | |
185 | D | A | -1.1673 | |
186 | P | A | -1.1240 | |
187 | A | A | -0.8308 | |
188 | W | A | 0.0000 | |
189 | E | A | -1.9633 | |
190 | R | A | -1.3958 | |
191 | N | A | 0.0000 | |
192 | D | A | 0.0000 | |
193 | P | A | 0.0000 | |
194 | T | A | -1.2199 | |
195 | Q | A | -1.5830 | |
196 | Q | A | 0.0000 | |
197 | I | A | 0.0000 | |
198 | P | A | -1.0718 | |
199 | K | A | -1.4587 | |
200 | L | A | 0.0000 | |
201 | V | A | -1.3331 | |
202 | A | A | -0.9492 | |
203 | N | A | -1.5213 | |
204 | N | A | -1.7348 | |
205 | T | A | 0.0000 | |
206 | R | A | -1.3513 | |
207 | L | A | 0.0000 | |
208 | W | A | 0.0000 | |
209 | V | A | 0.0000 | |
210 | Y | A | 0.0000 | |
211 | C | A | 0.0000 | |
212 | G | A | 0.0000 | |
213 | N | A | -0.4199 | |
214 | G | A | 0.0000 | |
215 | T | A | -0.7359 | |
216 | P | A | -1.6080 | |
217 | N | A | -2.1599 | |
218 | E | A | -2.2121 | |
219 | L | A | -1.0933 | |
220 | G | A | -1.1759 | |
221 | G | A | -0.8559 | |
222 | A | A | -0.6619 | |
223 | N | A | -0.0130 | |
224 | I | A | 1.7740 | |
225 | P | A | 0.8736 | |
226 | A | A | 0.0000 | |
227 | E | A | 0.4521 | |
228 | F | A | 2.0190 | |
229 | L | A | 1.3948 | |
230 | E | A | 0.0000 | |
231 | N | A | -0.4575 | |
232 | F | A | 0.8772 | |
233 | V | A | 0.0000 | |
234 | R | A | -0.4718 | |
235 | S | A | -0.7407 | |
236 | S | A | -0.8866 | |
237 | N | A | 0.0000 | |
238 | L | A | -0.6886 | |
239 | K | A | -2.4023 | |
240 | F | A | 0.0000 | |
241 | Q | A | 0.0000 | |
242 | D | A | -2.6746 | |
243 | A | A | -1.8151 | |
244 | Y | A | 0.0000 | |
245 | N | A | -2.3557 | |
246 | A | A | -1.2572 | |
247 | A | A | -0.9141 | |
248 | G | A | -1.1349 | |
249 | G | A | -1.7521 | |
250 | H | A | -1.6687 | |
251 | N | A | -1.2898 | |
252 | A | A | -0.2830 | |
253 | V | A | 1.0368 | |
254 | F | A | 1.3563 | |
255 | N | A | 0.9051 | |
256 | F | A | 1.3972 | |
257 | P | A | 0.3354 | |
258 | P | A | -0.3807 | |
259 | N | A | -0.8385 | |
260 | G | A | 0.0000 | |
261 | T | A | 0.0000 | |
262 | H | A | -0.1579 | |
263 | S | A | -0.5280 | |
264 | W | A | -0.6089 | |
265 | E | A | -0.9854 | |
266 | Y | A | 0.0000 | |
267 | W | A | 0.0000 | |
268 | G | A | 0.0000 | |
269 | A | A | -0.3407 | |
270 | Q | A | 0.0000 | |
271 | L | A | 0.0000 | |
272 | N | A | -0.7033 | |
273 | A | A | -0.7223 | |
274 | M | A | 0.0000 | |
275 | K | A | -1.4259 | |
276 | G | A | -1.7211 | |
277 | D | A | -2.2175 | |
278 | L | A | 0.0000 | |
279 | Q | A | -1.4394 | |
280 | S | A | -1.2942 | |
281 | S | A | -0.9750 | |
282 | L | A | -0.6185 | |
283 | G | A | -0.8682 | |
284 | A | A | -1.0197 | |
285 | G | A | -0.8985 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
IE224A | -1.0452 | -0.0224 | View | CSV | PDB |
IR224A | -0.4653 | -0.0324 | View | CSV | PDB |
FK228A | -0.2356 | -0.0247 | View | CSV | PDB |
FR228A | -0.1644 | -0.026 | View | CSV | PDB |
VR253A | -0.5169 | -0.0076 | View | CSV | PDB |
FR256A | -0.08 | -0.0115 | View | CSV | PDB |
VK253A | -0.7666 | -0.0019 | View | CSV | PDB |
FD254A | 1.6385 | -0.011 | View | CSV | PDB |
FR254A | 1.0873 | -0.007 | View | CSV | PDB |
LK229A | 0.4786 | -0.0019 | View | CSV | PDB |
LE229A | 1.4253 | -0.0022 | View | CSV | PDB |
FE256A | -1.7364 | 0.0005 | View | CSV | PDB |