Project name: 3c9963d0f16b3ea

Status: done

Started: 2026-05-22 07:28:34
Settings
Chain sequence(s) A: RRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:20)
Show buried residues

Minimal score value
-4.8392
Maximal score value
0.4385
Average score
-1.2718
Total score value
-78.8531

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 R A -2.4291
2 R A -2.2661
3 I A -0.3028
4 R A -1.6041
5 T A -0.7377
6 T A -0.1445
7 F A -0.0371
8 T A -0.1629
9 S A -0.4681
10 A A -0.5028
11 Q A -1.0480
12 L A -0.6507
13 K A -1.9666
14 E A 0.0000
15 L A 0.0000
16 E A -1.8349
17 R A -2.0528
18 V A 0.0000
19 F A 0.0000
20 A A -1.3750
21 E A -2.0047
22 T A -0.9556
23 H A -0.4904
24 Y A 0.4073
25 P A 0.0000
26 D A -0.5837
27 I A 0.2413
28 Y A 0.2721
29 T A -0.4103
30 R A -1.1155
31 E A -1.6687
32 E A -2.1550
33 L A 0.0000
34 A A 0.0000
35 L A -0.8634
36 K A -2.1484
37 I A 0.0000
38 D A -1.8939
39 L A -1.0222
40 T A -0.8085
41 E A -0.8299
42 A A -0.4594
43 R A -0.7400
44 V A 0.0000
45 Q A -0.5950
46 V A 0.4385
47 W A -0.2972
48 F A 0.0000
49 Q A -1.4932
50 N A -1.6733
51 R A -2.1298
52 R A -2.0663
53 A A -2.7336
54 K A -3.8310
55 F A -3.3668
56 R A -4.5504
57 K A -4.8392
58 Q A -4.3376
59 E A -4.4840
60 R A -4.0185
61 A A -2.4389
62 A A -1.6247
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018