Project name: query_structure

Status: done

Started: 2026-03-16 20:41:44
Settings
Chain sequence(s) A: MAGLWKTFVLVVALAVVSCEALRQLRYEEIVDRAIEAYNQGRQGRPLFRLLSATPPSSQNPATNIPLQFRIKETECTSTQERQPKDCDFLEDGEERNCTGKFFRRRQSTSLTLTCDRDCSREDTQETSFNDKQDVSEKEKFEDVPPHIRNIYEDAKYDIIGNILKNF
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:23)
Show buried residues

Minimal score value
-4.1474
Maximal score value
4.5002
Average score
-1.0536
Total score value
-175.9527

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.4649
2 A A 0.7407
3 G A 0.7495
4 L A 2.3798
5 W A 2.4125
6 K A 0.8088
7 T A 2.0807
8 F A 3.8324
9 V A 3.0370
10 L A 3.6329
11 V A 4.5002
12 V A 3.9507
13 A A 3.6999
14 L A 4.2931
15 A A 3.0898
16 V A 3.4434
17 V A 3.1675
18 S A 1.5840
19 C A 0.9480
20 E A -0.8973
21 A A -0.5489
22 L A -0.2999
23 R A -2.3123
24 Q A -2.3601
25 L A -1.9197
26 R A -3.2590
27 Y A 0.0000
28 E A -3.0681
29 E A -2.7268
30 I A 0.0000
31 V A 0.0000
32 D A -2.8330
33 R A -2.3098
34 A A 0.0000
35 I A 0.0000
36 E A -2.9558
37 A A -1.7026
38 Y A 0.0000
39 N A 0.0000
40 Q A -2.3168
41 G A -2.1356
42 R A -2.4567
43 Q A -2.6477
44 G A -2.0565
45 R A -2.8261
46 P A -1.9778
47 L A 0.0000
48 F A 0.0000
49 R A -1.5975
50 L A -0.1988
51 L A 0.2453
52 S A -0.2336
53 A A -0.5973
54 T A -0.6624
55 P A -0.8866
56 P A -0.8217
57 S A -0.8429
58 S A -1.3701
59 Q A -2.2383
60 N A -2.1266
61 P A -1.5368
62 A A -1.0856
63 T A -1.2512
64 N A -0.9262
65 I A -0.7019
66 P A -0.5321
67 L A 0.0000
68 Q A -0.9919
69 F A 0.0000
70 R A -1.4580
71 I A 0.0000
72 K A -1.3063
73 E A -1.6865
74 T A 0.0000
75 E A -2.5861
76 C A 0.0000
77 T A -2.3350
78 S A -2.6767
79 T A -2.1451
80 Q A -2.9575
81 E A -3.4606
82 R A -4.1123
83 Q A -3.8177
84 P A -3.4760
85 K A -3.0886
86 D A -3.5495
87 C A 0.0000
88 D A -3.0027
89 F A -2.0132
90 L A -2.0372
91 E A -2.9487
92 D A -2.6328
93 G A 0.0000
94 E A -1.8175
95 E A -2.0820
96 R A -2.3274
97 N A -2.1897
98 C A 0.0000
99 T A -0.9674
100 G A -0.4403
101 K A -0.9177
102 F A 0.0000
103 F A -0.3093
104 R A -1.8933
105 R A -3.1836
106 R A -3.1170
107 Q A -2.5073
108 S A -1.8694
109 T A -1.0831
110 S A -0.3529
111 L A 0.0050
112 T A -0.0439
113 L A 0.0414
114 T A -0.6513
115 C A -1.6743
116 D A -3.0555
117 R A -3.5423
118 D A -2.5033
119 C A -1.8057
120 S A -1.9995
121 R A -3.7146
122 E A -4.1474
123 D A -3.9671
124 T A -3.0178
125 Q A -3.2263
126 E A -2.7938
127 T A -1.0107
128 S A -0.5080
129 F A 0.1453
130 N A -1.7772
131 D A -3.3165
132 K A -3.4208
133 Q A -3.0599
134 D A -2.4448
135 V A -1.1853
136 S A -2.1161
137 E A -3.4386
138 K A -3.8381
139 E A -4.0769
140 K A -3.8672
141 F A -3.1689
142 E A -3.8877
143 D A -3.1444
144 V A -1.6546
145 P A -1.2452
146 P A -1.3082
147 H A -0.9736
148 I A 0.0795
149 R A -1.5776
150 N A -1.7728
151 I A -0.0535
152 Y A -0.4233
153 E A -1.9019
154 D A -1.9584
155 A A -0.7779
156 K A -0.5023
157 Y A 0.3120
158 D A -0.6479
159 I A 1.5117
160 I A 2.0078
161 G A 0.4323
162 N A -0.1066
163 I A 1.6381
164 L A 1.5452
165 K A -0.6687
166 N A -0.6058
167 F A 1.4105
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018