Project name: blg

Status: done

Started: 2026-03-01 13:06:56
Settings
Chain sequence(s) A: MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:32)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:33)
Show buried residues

Minimal score value
-3.5984
Maximal score value
3.4537
Average score
-0.7913
Total score value
-140.8474

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3890
2 K A -0.4196
3 C A 1.3506
4 L A 2.6716
5 L A 3.4537
6 L A 3.2437
7 A A 2.2837
8 L A 2.5869
9 A A 1.8301
10 L A 2.1461
11 T A 1.1239
12 C A 0.7961
13 G A -0.2359
14 A A -0.2934
15 Q A -0.6109
16 A A 0.7242
17 L A 2.2429
18 I A 2.0702
19 V A 2.5160
20 T A 0.9883
21 Q A -0.3505
22 T A -0.5222
23 M A -1.1249
24 K A -1.9987
25 G A -1.3269
26 L A 0.0000
27 D A -1.8741
28 I A -1.6827
29 Q A -2.3394
30 K A -2.7623
31 V A 0.0000
32 A A -1.2438
33 G A -0.9292
34 T A -0.4639
35 W A 0.0000
36 Y A -0.5664
37 S A 0.0000
38 L A 0.0000
39 A A 0.0000
40 M A 0.0000
41 A A 0.0000
42 A A 0.0000
43 S A 0.0000
44 D A -0.8355
45 I A 0.1455
46 S A -0.4390
47 L A -0.5399
48 L A 0.0000
49 D A -1.8207
50 A A -1.3580
51 Q A -1.6199
52 S A -1.7780
53 A A 0.0000
54 P A -0.8498
55 L A 0.0000
56 R A -0.8280
57 V A 0.0000
58 Y A 0.0000
59 V A 0.0000
60 E A -0.7233
61 E A -0.9348
62 L A 0.0000
63 K A -1.2136
64 P A -1.4978
65 T A -1.5488
66 P A -1.4748
67 E A -2.5603
68 G A -2.3970
69 D A -2.4063
70 L A 0.0000
71 E A -0.7814
72 I A 0.0000
73 L A -0.9894
74 L A 0.0000
75 Q A 0.0000
76 K A 0.0000
77 W A -1.7078
78 E A -2.7110
79 N A -2.5655
80 G A -2.3840
81 E A -2.9106
82 C A -1.7233
83 A A -1.7591
84 Q A -2.1906
85 K A -1.9302
86 K A -1.8537
87 I A 0.0000
88 I A -0.0484
89 A A 0.0000
90 E A -3.2237
91 K A -3.2374
92 T A -2.0396
93 K A -1.6137
94 I A -0.4641
95 P A -1.0283
96 A A 0.0000
97 V A 0.0000
98 F A 0.0000
99 K A -2.4662
100 I A 0.0000
101 D A -2.3307
102 A A -1.3395
103 L A -0.9009
104 N A -1.7525
105 E A 0.0000
106 N A -1.8311
107 K A -1.7239
108 V A 0.0000
109 L A 0.0000
110 V A 0.0000
111 L A 0.0000
112 D A -1.0011
113 T A 0.0000
114 D A -1.5532
115 Y A -2.0178
116 K A -2.8031
117 K A -2.7447
118 Y A 0.0000
119 L A 0.0000
120 L A 0.0000
121 F A 0.0000
122 C A 0.0000
123 M A 0.0000
124 E A -1.5870
125 N A -2.0577
126 S A -1.3505
127 A A -1.4176
128 E A -2.9010
129 P A -2.3240
130 E A -2.9964
131 Q A -2.7011
132 S A 0.0000
133 L A 0.0000
134 A A 0.0000
135 C A 0.0000
136 Q A 0.0000
137 C A 0.0000
138 L A 0.0000
139 V A 0.0000
140 R A -1.6388
141 T A -1.2641
142 P A -1.5484
143 E A -1.8500
144 V A -0.4205
145 D A -1.7962
146 D A -2.9650
147 E A -3.3241
148 A A 0.0000
149 L A -2.2679
150 E A -3.5984
151 K A -2.9375
152 F A 0.0000
153 D A -2.8945
154 K A -3.2186
155 A A -2.1231
156 L A 0.0000
157 K A -2.4420
158 A A -0.7975
159 L A 0.0000
160 P A -0.8885
161 M A -0.7972
162 H A -0.7296
163 I A -0.5611
164 R A -1.0701
165 L A -0.4331
166 S A -0.2990
167 F A 0.0000
168 N A -1.5499
169 P A -1.6550
170 T A -1.5185
171 Q A -1.4601
172 L A 0.0000
173 E A -3.0224
174 E A -2.5156
175 Q A -2.1229
176 C A 0.0000
177 H A 0.0000
178 I A 0.8318
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018