Project name: scFv aggregation prediction

Status: done

Started: 2026-05-28 07:22:02
Settings
Chain sequence(s) A: DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGTKLEITGGGGSGGGGSGGGGSEVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGVIWGSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWGQGTSVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:09)
Show buried residues

Minimal score value
-3.0276
Maximal score value
1.806
Average score
-0.7334
Total score value
-177.4921

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -2.1864
2 I A 0.0000
3 Q A -2.0148
4 M A 0.0000
5 T A -1.1528
6 Q A 0.0000
7 T A -0.5155
8 T A -0.4428
9 S A -0.6982
10 S A -1.0139
11 L A -0.6567
12 S A -0.8702
13 A A -0.7908
14 S A -0.9879
15 L A -0.7462
16 G A -1.5485
17 D A -2.1385
18 R A -2.7028
19 V A 0.0000
20 T A -0.6150
21 I A 0.0000
22 S A -0.8566
23 C A 0.0000
24 R A -2.6587
25 A A 0.0000
26 S A -2.2117
27 Q A -2.7991
28 D A -3.0276
29 I A 0.0000
30 S A -1.7168
31 K A -1.8901
32 Y A -0.9105
33 L A 0.0000
34 N A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A 0.0000
39 K A -1.5022
40 P A -1.3396
41 D A -2.2245
42 G A -1.4597
43 T A -1.3436
44 V A 0.0000
45 K A -1.0189
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A -0.0317
50 H A -0.7668
51 T A 0.0000
52 S A -0.8619
53 R A -0.7593
54 L A -0.1210
55 H A -0.4495
56 S A -0.4440
57 G A -0.5825
58 V A -0.2851
59 P A -0.2939
60 S A -0.4931
61 R A -1.0134
62 F A 0.0000
63 S A -0.4400
64 G A -0.4611
65 S A -0.9942
66 G A -1.3523
67 S A -1.5605
68 G A -1.9925
69 T A -2.3899
70 D A -2.3983
71 Y A 0.0000
72 S A -0.8196
73 L A 0.0000
74 T A -0.7721
75 I A 0.0000
76 S A -1.8770
77 N A -2.3327
78 L A 0.0000
79 E A -1.8803
80 Q A -2.5419
81 E A -2.7722
82 D A 0.0000
83 I A -1.3195
84 A A 0.0000
85 T A -0.8714
86 Y A 0.0000
87 F A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 G A 0.0000
92 N A -0.9030
93 T A -0.3017
94 L A 0.1269
95 P A -0.1876
96 Y A 0.0000
97 T A -0.6644
98 F A -0.2609
99 G A 0.0000
100 G A -0.9937
101 G A 0.0000
102 T A 0.0000
103 K A -1.6988
104 L A 0.0000
105 E A -1.9481
106 I A -1.0082
107 T A -0.6286
108 G A -0.9013
109 G A -1.2457
110 G A -1.0421
111 G A -1.2806
112 S A -1.2901
113 G A -1.6027
114 G A -1.7108
115 G A -1.4031
116 G A -1.3641
117 S A -0.9840
118 G A -1.3807
119 G A -1.4521
120 G A -1.4942
121 G A -1.5539
122 S A -1.7362
123 E A -2.7564
124 V A -1.6132
125 K A -2.4533
126 L A 0.0000
127 Q A -1.8234
128 E A 0.0000
129 S A -0.8044
130 G A -0.3723
131 P A -0.0786
132 G A 0.1188
133 L A 1.1584
134 V A 0.0000
135 A A -0.3977
136 P A -1.2158
137 S A -1.4338
138 Q A -1.7891
139 S A -1.6353
140 L A 0.0000
141 S A -0.6932
142 V A 0.0000
143 T A -0.3315
144 C A 0.0000
145 T A -1.1133
146 V A 0.0000
147 S A -1.5234
148 G A -1.4399
149 V A -0.7159
150 S A -0.7868
151 L A 0.0000
152 P A -1.6677
153 D A -1.8365
154 Y A -0.4595
155 G A 0.0000
156 V A 0.0000
157 S A 0.0000
158 W A 0.0000
159 I A 0.0000
160 R A 0.0000
161 Q A -0.9121
162 P A 0.0000
163 P A -1.7948
164 R A -2.7338
165 K A -2.7150
166 G A -1.5552
167 L A 0.0000
168 E A -0.8013
169 W A 0.0000
170 L A 0.0000
171 G A 0.0000
172 V A 0.0000
173 I A 0.0000
174 W A -0.7642
175 G A -1.4885
176 S A -1.3671
177 E A -1.7875
178 T A -0.7353
179 T A -0.0295
180 Y A 0.4216
181 Y A -0.0958
182 N A -0.6674
183 S A -0.8485
184 A A -0.5481
185 L A -0.9866
186 K A -1.7690
187 S A -1.3323
188 R A -1.4685
189 L A 0.0000
190 T A -0.5301
191 I A 0.0000
192 I A 0.0724
193 K A -0.9715
194 D A -1.7063
195 N A -2.3959
196 S A -1.8470
197 K A -2.4597
198 S A -1.7514
199 Q A -1.2927
200 V A 0.0000
201 F A 0.1668
202 L A 0.0000
203 K A -1.0471
204 M A 0.0000
205 N A -2.0199
206 S A -1.5780
207 L A 0.0000
208 Q A -2.2399
209 T A -1.6007
210 D A -2.2708
211 D A 0.0000
212 T A -0.7119
213 A A 0.0000
214 I A 0.1625
215 Y A 0.0000
216 Y A 0.0000
217 C A 0.0000
218 A A 0.0000
219 K A 0.0000
220 H A 0.0000
221 Y A 1.4376
222 Y A 1.8060
223 Y A 1.0410
224 G A -0.0003
225 G A -0.1335
226 S A 0.0000
227 Y A 0.9457
228 A A 0.0000
229 M A 0.0000
230 D A 0.2680
231 Y A 0.0903
232 W A -0.5386
233 G A 0.0000
234 Q A -1.7815
235 G A 0.0000
236 T A -0.5622
237 S A -0.1272
238 V A 0.0000
239 T A 0.0171
240 V A 0.0000
241 S A -0.3368
242 S A -0.1258
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018