Project name: Nb_E

Chain sequence(s)	A: QVQLVESGGGLVQPGGSLRLSCAASGGSDFDFSNYSLGWFRQAPGQGLEAVAAINPLGQYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAANENIPRNMFNPSDYQYWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:40)

• Minimal score value: -2.9205
• Maximal score value: 1.7318
• Average score: -0.6012
• Total score value: -76.9503

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.7330
2	V	A	-1.4112
3	Q	A	-1.0664
4	L	A	0.0000
5	V	A	0.8451
6	E	A	0.3291
7	S	A	-0.1965
8	G	A	-0.7062
9	G	A	0.1281
10	G	A	0.7308
11	L	A	1.4523
12	V	A	-0.0419
13	Q	A	-1.3802
14	P	A	-1.8161
15	G	A	-1.5563
16	G	A	-1.0440
17	S	A	-1.3150
18	L	A	-0.9040
19	R	A	-2.1380
20	L	A	0.0000
21	S	A	-0.4576
22	C	A	0.0000
23	A	A	-0.2586
24	A	A	0.0000
25	S	A	-1.0190
26	G	A	-1.6280
27	G	A	-1.7467
28	S	A	-1.5946
29	D	A	-2.3734
30	F	A	-2.0438
31	D	A	-2.5085
32	F	A	0.0000
33	S	A	-1.4501
34	N	A	-1.9200
35	Y	A	0.0000
36	S	A	0.0000
37	L	A	0.0000
38	G	A	0.0000
39	W	A	0.0000
40	F	A	0.0000
41	R	A	0.0000
42	Q	A	-0.6422
43	A	A	-0.9522
44	P	A	-0.9759
45	G	A	-1.2585
46	Q	A	-1.7943
47	G	A	-1.1332
48	L	A	-0.2885
49	E	A	-0.5853
50	A	A	0.3325
51	V	A	0.0000
52	A	A	0.0000
53	A	A	0.0000
54	I	A	0.0000
55	N	A	0.0000
56	P	A	0.0242
57	L	A	0.9655
58	G	A	0.0819
59	Q	A	-0.1607
60	Y	A	0.9838
61	T	A	0.4223
62	Y	A	0.5332
63	Y	A	-0.4788
64	A	A	-1.0730
65	D	A	-2.4733
66	S	A	-1.7891
67	V	A	0.0000
68	K	A	-2.6013
69	G	A	-1.7571
70	R	A	-1.5265
71	F	A	0.0000
72	T	A	-0.8217
73	I	A	0.0000
74	S	A	-0.5348
75	R	A	-1.0766
76	D	A	-2.0723
77	N	A	-2.2577
78	S	A	-1.8525
79	K	A	-2.6139
80	N	A	-2.2053
81	T	A	0.0000
82	L	A	0.0000
83	Y	A	-0.6758
84	L	A	0.0000
85	Q	A	-1.2863
86	M	A	0.0000
87	N	A	-1.5404
88	S	A	-1.4130
89	L	A	0.0000
90	R	A	-2.9205
91	A	A	-2.0125
92	E	A	-2.4676
93	D	A	0.0000
94	T	A	-0.4862
95	A	A	0.0000
96	V	A	0.8377
97	Y	A	0.0000
98	Y	A	0.3129
99	C	A	0.0000
100	A	A	0.0000
101	A	A	0.0000
102	N	A	0.0000
103	E	A	-2.6512
104	N	A	-1.7864
105	I	A	0.3081
106	P	A	0.0000
107	R	A	-1.5080
108	N	A	-0.4683
109	M	A	0.0000
110	F	A	1.2656
111	N	A	-0.0720
112	P	A	-0.0748
113	S	A	-0.4102
114	D	A	0.0000
115	Y	A	0.0000
116	Q	A	-1.3970
117	Y	A	-0.6437
118	W	A	0.0329
119	G	A	-0.1410
120	Q	A	-0.9087
121	G	A	0.0345
122	T	A	0.5822
123	L	A	1.7318
124	V	A	0.0000
125	T	A	0.3607
126	V	A	0.0000
127	S	A	-0.7033
128	S	A	-0.4448