Project name: wt-pro_ESM

Status: done

Started: 2026-05-21 11:37:09
Settings
Chain sequence(s) A: MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREEAEAEAEPR
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:52)
Show buried residues

Minimal score value
-5.0676
Maximal score value
3.2844
Average score
-0.5131
Total score value
-48.7457

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.6614
2 R A -0.5036
3 F A 1.7940
4 P A 0.9414
5 S A 1.2263
6 I A 3.2601
7 F A 3.1099
8 T A 2.4147
9 A A 2.3531
10 V A 2.7629
11 L A 3.1347
12 F A 3.2844
13 A A 1.7895
14 A A 1.8928
15 S A 1.6763
16 S A 1.1516
17 A A 1.0073
18 L A 2.0443
19 A A 1.2316
20 A A 0.7810
21 P A 0.4907
22 V A 1.3451
23 N A -0.5767
24 T A -0.8121
25 T A -0.9479
26 T A -2.0222
27 E A -3.1717
28 D A -3.5753
29 E A -3.3082
30 T A -1.7003
31 A A -0.4816
32 Q A -0.8735
33 I A 0.5428
34 P A -0.3491
35 A A -0.4039
36 E A -0.8796
37 A A 0.0000
38 V A 2.0660
39 I A 2.4751
40 G A 1.5187
41 Y A 1.3732
42 S A 0.0086
43 D A -2.1244
44 L A -1.2225
45 E A -2.3288
46 G A -1.8584
47 D A -2.1089
48 F A -0.1774
49 D A -0.9132
50 V A 0.0000
51 A A 0.0000
52 V A 0.0000
53 L A 0.0000
54 P A 0.9792
55 F A -0.1905
56 S A -1.4721
57 N A -2.2055
58 S A -1.4254
59 T A -1.4903
60 N A -2.4690
61 N A -2.0685
62 G A -0.4690
63 L A 2.0515
64 L A 1.9390
65 F A 2.4301
66 I A 1.7491
67 N A 0.5501
68 T A 0.0000
69 T A 0.5293
70 I A 1.3084
71 A A 0.3876
72 S A 0.0185
73 I A 0.4804
74 A A -0.5388
75 A A -0.9377
76 K A -2.4635
77 E A -3.0323
78 E A -2.7954
79 G A -1.6424
80 V A -0.3076
81 S A -1.3453
82 L A -1.5083
83 E A -3.7768
84 K A -4.2233
85 R A -4.7125
86 E A -5.0676
87 E A -5.0301
88 A A -4.1567
89 E A -4.5540
90 A A -3.7596
91 E A -4.1014
92 A A -3.1046
93 E A -3.3805
94 P A -2.2859
95 R A -2.6525
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018