Project name: VHL_D73Y

Chain sequence(s)	A: MEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHYGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:42)

• Minimal score value: -4.3932
• Maximal score value: 1.8862
• Average score: -1.1418
• Total score value: -182.6811

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.1223
2	E	A	-1.7251
3	A	A	-1.2567
4	G	A	-2.1210
5	R	A	-2.9697
6	P	A	-2.0375
7	R	A	-2.5947
8	P	A	-1.3543
9	V	A	-0.0749
10	L	A	0.0000
11	R	A	-0.6779
12	S	A	0.0000
13	V	A	0.6346
14	N	A	-1.1099
15	S	A	-1.9095
16	R	A	-2.9956
17	E	A	-3.0923
18	P	A	-2.1780
19	S	A	0.0000
20	Q	A	-1.7610
21	V	A	0.0000
22	I	A	-1.0689
23	F	A	0.0000
24	C	A	-1.3006
25	N	A	0.0000
26	R	A	-2.2056
27	S	A	0.0000
28	P	A	-0.9890
29	R	A	-0.9479
30	V	A	-0.1529
31	V	A	0.0000
32	L	A	0.0815
33	P	A	0.0000
34	V	A	0.0000
35	W	A	-0.2971
36	L	A	0.0000
37	N	A	-1.0444
38	F	A	-0.7404
39	D	A	-2.1881
40	G	A	-1.7191
41	E	A	-2.6282
42	P	A	-1.5152
43	Q	A	-0.9454
44	P	A	-0.4181
45	Y	A	0.1937
46	P	A	-0.2464
47	T	A	-0.0751
48	L	A	0.0000
49	P	A	-0.6237
50	P	A	-1.0905
51	G	A	-1.2984
52	T	A	-1.1878
53	G	A	-1.9683
54	R	A	-2.7680
55	R	A	-2.8658
56	I	A	-1.8150
57	H	A	-1.7518
58	S	A	0.0000
59	Y	A	-1.6203
60	R	A	-2.0462
61	G	A	-0.4347
62	H	A	0.0000
63	L	A	0.0000
64	W	A	0.0000
65	L	A	0.0000
66	F	A	0.0000
67	R	A	0.0000
68	D	A	0.0000
69	A	A	-0.3025
70	G	A	-0.5365
71	T	A	-0.7672
72	H	A	-0.8490
73	Y	A	-0.5549
74	G	A	-0.5099
75	L	A	0.0000
76	L	A	-0.7206
77	V	A	0.0000
78	N	A	-1.6320
79	Q	A	-1.8847
80	T	A	-1.5897
81	E	A	-1.8719
82	L	A	0.0000
83	F	A	0.0000
84	V	A	1.1970
85	P	A	0.0000
86	S	A	-0.2013
87	L	A	-0.4306
88	N	A	-0.7602
89	V	A	0.4075
90	D	A	-1.5452
91	G	A	-1.4872
92	Q	A	-1.4715
93	P	A	-0.7872
94	I	A	0.3095
95	F	A	0.3030
96	A	A	0.0000
97	N	A	-0.9874
98	I	A	0.0000
99	T	A	-0.7318
100	L	A	0.4064
101	P	A	0.8424
102	V	A	1.8862
103	Y	A	0.6004
104	T	A	0.1543
105	L	A	0.4484
106	K	A	-1.2082
107	E	A	-1.3801
108	R	A	-1.2969
109	C	A	-0.5438
110	L	A	0.0000
111	Q	A	-0.4213
112	V	A	0.4363
113	V	A	0.5203
114	R	A	-0.2120
115	S	A	0.4923
116	L	A	1.3515
117	V	A	-0.2500
118	K	A	-2.1702
119	P	A	-2.4626
120	E	A	-3.4910
121	N	A	-3.1565
122	Y	A	0.0000
123	R	A	-3.2338
124	R	A	-3.1157
125	L	A	-1.6661
126	D	A	-1.8171
127	I	A	-0.0866
128	V	A	0.7707
129	R	A	-1.5899
130	S	A	-0.9425
131	L	A	-1.2555
132	Y	A	0.0000
133	E	A	-3.6966
134	D	A	-3.1312
135	L	A	0.0000
136	E	A	-4.0715
137	D	A	-3.8046
138	H	A	-2.9061
139	P	A	-2.0098
140	N	A	-2.3012
141	V	A	-2.0866
142	Q	A	-3.2625
143	K	A	-3.8359
144	D	A	-3.2739
145	L	A	0.0000
146	E	A	-4.2357
147	R	A	-4.3932
148	L	A	-3.0570
149	T	A	-2.6172
150	Q	A	-3.3948
151	E	A	-3.8455
152	R	A	-3.2352
153	I	A	-1.6847
154	A	A	-2.2273
155	H	A	-2.9809
156	Q	A	-3.2480
157	R	A	-2.9005
158	M	A	-1.2260
159	G	A	-2.0269
160	D	A	-2.6545