Project name: query_structure

Status: done

Started: 2026-03-17 01:09:34
Settings
Chain sequence(s) A: VSDVPRDLEVVAATPTSLLISWDAPAVTVDFYVITYGETGGWWYAAQEFTVPGSKSTATISGLKPGVDYTITVYAYPDHHYQGRSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:38)
Show buried residues

Minimal score value
-3.373
Maximal score value
2.0523
Average score
-0.7389
Total score value
-68.7222

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7270
2 S A 0.3434
3 D A -0.2404
4 V A -0.7398
5 P A 0.0000
6 R A -3.1039
7 D A -3.3730
8 L A 0.0000
9 E A -2.1236
10 V A 0.0791
11 V A 1.5327
12 A A 0.8878
13 A A 0.2920
14 T A -0.3423
15 P A -1.1223
16 T A -0.9944
17 S A -0.5321
18 L A 0.0000
19 L A 0.7307
20 I A 0.0000
21 S A -1.1578
22 W A 0.0000
23 D A -3.2132
24 A A -1.5949
25 P A 0.0000
26 A A 0.3193
27 V A 0.5874
28 T A -0.4002
29 V A -1.1586
30 D A -2.4268
31 F A -1.4002
32 Y A 0.0000
33 V A 0.0000
34 I A 0.0000
35 T A 0.0000
36 Y A -0.8003
37 G A -0.8650
38 E A -1.9502
39 T A -1.4634
40 G A -0.7267
41 G A -0.0568
42 W A 1.7429
43 W A 1.9881
44 Y A 2.0523
45 A A 0.7682
46 A A -0.0688
47 Q A -1.3886
48 E A -1.9800
49 F A -0.5611
50 T A -0.1531
51 V A 0.0000
52 P A -1.1551
53 G A -1.3981
54 S A -1.4162
55 K A -2.2593
56 S A -1.4535
57 T A -0.7882
58 A A 0.0000
59 T A 0.2335
60 I A 0.0000
61 S A -0.6574
62 G A -1.0271
63 L A 0.0000
64 K A -2.5559
65 P A -1.7939
66 G A -1.6866
67 V A -2.0103
68 D A -3.2636
69 Y A 0.0000
70 T A -1.3480
71 I A 0.0000
72 T A 0.0000
73 V A 0.0000
74 Y A -0.0954
75 A A 0.0000
76 Y A 0.0000
77 P A -1.7155
78 D A -2.6593
79 H A -2.2679
80 H A -1.7265
81 Y A -0.4195
82 Q A -1.4639
83 G A -1.3047
84 R A -1.3299
85 S A -0.8947
86 P A -0.5885
87 I A -0.4475
88 S A -0.7301
89 I A -0.7656
90 N A -2.0459
91 Y A -1.8755
92 R A -3.0413
93 T A -1.8842
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018