Project name: 3dc3e9597b6f411

Chain sequence(s)	A: SFMLTQPPSVSGSPGRTVAISCTRTSGTIASGFVHWYQQRPGSPPTLLIFENDQRSAGVSERFSGSLDSSSNTATLTISGLKTEDEAHYHCQSFERMTWVFGGGTKLTVL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:52)

• Minimal score value: -2.75
• Maximal score value: 1.8055
• Average score: -0.5297
• Total score value: -58.267

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	A	-0.3308
2	F	A	0.0000
3	M	A	1.0294
4	L	A	0.0000
5	T	A	0.0269
6	Q	A	-0.3696
7	P	A	-0.5099
8	P	A	-0.7738
9	S	A	-0.7020
10	V	A	-0.2637
11	S	A	-0.0364
12	G	A	-0.2707
13	S	A	-0.4346
14	P	A	-1.1502
15	G	A	-1.8832
16	R	A	-2.4357
17	T	A	-1.3725
18	V	A	0.0000
19	A	A	-0.0312
20	I	A	0.0000
21	S	A	-0.1538
22	C	A	0.0000
23	T	A	-0.2820
24	R	A	-0.2303
25	T	A	-0.0824
26	S	A	-0.3961
27	G	A	-0.7268
28	T	A	-0.7052
29	I	A	0.0000
30	A	A	-0.0715
31	S	A	-0.0040
32	G	A	0.2094
33	F	A	0.8491
34	V	A	0.0000
35	H	A	-0.0266
36	W	A	0.0000
37	Y	A	0.0768
38	Q	A	0.0000
39	Q	A	-1.6599
40	R	A	-2.4176
41	P	A	-1.4546
42	G	A	-1.0443
43	S	A	-1.0090
44	P	A	-0.7773
45	P	A	-0.7695
46	T	A	-0.2132
47	L	A	0.3305
48	L	A	0.0000
49	I	A	0.0000
50	F	A	-0.7578
51	E	A	-1.3915
52	N	A	-1.3620
53	D	A	-2.6017
54	Q	A	-2.4247
55	R	A	-2.0119
56	S	A	-0.6780
57	A	A	-0.6033
58	G	A	-0.7015
59	V	A	-0.6278
60	S	A	-1.1869
61	E	A	-2.1879
62	R	A	-1.3079
63	F	A	0.0000
64	S	A	-1.4119
65	G	A	-1.3540
66	S	A	-1.1560
67	L	A	-0.6256
68	D	A	-1.3185
69	S	A	-0.9780
70	S	A	-0.8097
71	S	A	-0.8257
72	N	A	-0.9313
73	T	A	-0.7080
74	A	A	0.0000
75	T	A	-0.5180
76	L	A	0.0000
77	T	A	-0.2144
78	I	A	0.0000
79	S	A	-1.3791
80	G	A	-1.6927
81	L	A	0.0000
82	K	A	-2.3767
83	T	A	-1.7255
84	E	A	-2.7500
85	D	A	0.0000
86	E	A	-2.4467
87	A	A	0.0000
88	H	A	-1.9375
89	Y	A	0.0000
90	H	A	-0.3027
91	C	A	0.0000
92	Q	A	0.0000
93	S	A	0.0000
94	F	A	1.3958
95	E	A	0.0944
96	R	A	-1.0648
97	M	A	0.5847
98	T	A	0.8206
99	W	A	1.8055
100	V	A	1.6325
101	F	A	1.7927
102	G	A	0.4567
103	G	A	-0.3734
104	G	A	-0.7136
105	T	A	0.0000
106	K	A	-1.8115
107	L	A	0.0000
108	T	A	-0.4451
109	V	A	-0.2916
110	L	A	1.2213