Project name: lanm_C5

Chain sequence(s)	A: APTTTTKVDIAAFNPDKDGTIELKEALAAGSAAFDKLDPDKDGTLEAKELKGRVSEADLKKLDPDNDGTLEKKEYLAAVEAQFKAANPDNDGTIEARELASPAGSALVNLIR
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)

• Minimal score value: -4.0171
• Maximal score value: 0.0
• Average score: -1.4576
• Total score value: -163.2568

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	A	A	-0.0965
2	P	A	-0.2991
3	T	A	-0.2464
4	T	A	-0.5174
5	T	A	-0.7175
6	T	A	-1.1165
7	K	A	-2.2711
8	V	A	-1.5088
9	D	A	-1.9140
10	I	A	-1.2519
11	A	A	-1.2752
12	A	A	-0.7360
13	F	A	-0.8122
14	N	A	0.0000
15	P	A	-1.8933
16	D	A	-3.3591
17	K	A	-3.5573
18	D	A	-3.4627
19	G	A	-2.2078
20	T	A	-1.5290
21	I	A	0.0000
22	E	A	-1.4680
23	L	A	-0.9498
24	K	A	-1.5913
25	E	A	0.0000
26	A	A	0.0000
27	L	A	-0.1628
28	A	A	-0.1310
29	A	A	-0.4555
30	G	A	0.0000
31	S	A	-0.6306
32	A	A	-0.9113
33	A	A	0.0000
34	F	A	0.0000
35	D	A	-2.6950
36	K	A	-2.8052
37	L	A	-2.0668
38	D	A	0.0000
39	P	A	-2.6103
40	D	A	-3.6256
41	K	A	-4.0171
42	D	A	-3.5738
43	G	A	-2.8217
44	T	A	-2.4888
45	L	A	0.0000
46	E	A	-1.9735
47	A	A	-2.4088
48	K	A	-2.8477
49	E	A	-2.0885
50	L	A	0.0000
51	K	A	-3.0391
52	G	A	-1.9862
53	R	A	-1.7332
54	V	A	-1.5850
55	S	A	-2.2204
56	E	A	-3.2896
57	A	A	-2.1946
58	D	A	-2.6401
59	L	A	0.0000
60	K	A	-4.0027
61	K	A	-3.4345
62	L	A	-2.2093
63	D	A	0.0000
64	P	A	-2.5528
65	D	A	-3.5402
66	N	A	-3.8224
67	D	A	-3.6145
68	G	A	-2.6477
69	T	A	-2.3682
70	L	A	0.0000
71	E	A	-2.6820
72	K	A	-2.2655
73	K	A	-2.4237
74	E	A	-1.7970
75	Y	A	0.0000
76	L	A	-0.7233
77	A	A	-0.6967
78	A	A	0.0000
79	V	A	0.0000
80	E	A	-1.0591
81	A	A	-0.8209
82	Q	A	-0.8729
83	F	A	0.0000
84	K	A	-2.5830
85	A	A	-1.3754
86	A	A	0.0000
87	N	A	0.0000
88	P	A	-2.1247
89	D	A	-3.2503
90	N	A	-3.5057
91	D	A	-3.3627
92	G	A	-2.4139
93	T	A	-1.8509
94	I	A	0.0000
95	E	A	-1.3878
96	A	A	-1.5439
97	R	A	-2.0998
98	E	A	0.0000
99	L	A	0.0000
100	A	A	-1.2474
101	S	A	-0.5925
102	P	A	-0.3034
103	A	A	-0.4698
104	G	A	0.0000
105	S	A	-0.4449
106	A	A	-0.2918
107	L	A	0.0000
108	V	A	0.0000
109	N	A	-1.0536
110	L	A	0.0000
111	I	A	0.0000
112	R	A	-2.0388