Project name: Rat IAPP_20

Status: done

Started: 2026-06-25 11:53:23
Settings
Chain sequence(s) A: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
C: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
B: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
E: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
D: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
input PDB
Selected Chain(s) A,C,B,E,D
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:03)
Show buried residues

Minimal score value
-2.2638
Maximal score value
0.6176
Average score
-0.7251
Total score value
-134.1518

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 K A -2.1505
2 C A -1.7965
3 N A -1.8895
4 T A -1.2468
5 A A -0.7100
6 T A -0.9366
7 C A -0.9079
8 A A 0.0000
9 T A 0.0000
10 Q A -0.6750
11 R A -0.8571
12 L A 0.0000
13 A A 0.0000
14 N A -0.7559
15 F A 0.0000
16 L A -0.5122
17 V A 0.0000
18 R A -1.3261
19 S A 0.0000
20 S A 0.0000
21 N A -1.6908
22 N A -1.3207
23 L A 0.5868
24 G A -0.0384
25 P A -0.2224
26 V A 0.2252
27 L A -0.4175
28 P A -0.9915
29 P A -1.1517
30 T A 0.0000
31 N A -1.4550
32 V A -0.9385
33 G A -1.2064
34 S A -1.1531
35 N A -1.3455
36 T A -0.3857
37 Y A 0.5120
1 K B -1.8988
2 C B -1.4733
3 N B -1.8106
4 T B -0.8635
5 A B 0.0000
6 T B 0.0000
7 C B -0.6609
8 A B 0.0000
9 T B 0.0000
10 Q B -0.6571
11 R B -0.8263
12 L B 0.0000
13 A B 0.0000
14 N B -1.2328
15 F B 0.0000
16 L B -0.8123
17 V B 0.0000
18 R B -1.9594
19 S B 0.0000
20 S B 0.0000
21 N B -1.7954
22 N B -1.3744
23 L B 0.5364
24 G B -0.0234
25 P B -0.5194
26 V B -0.3785
27 L B 0.0000
28 P B -1.0898
29 P B -1.2611
30 T B -0.9808
31 N B -1.4506
32 V B -0.8463
33 G B -1.1423
34 S B -1.1725
35 N B -1.4089
36 T B -0.4439
37 Y B 0.5076
1 K C -2.0184
2 C C -1.6866
3 N C -1.9499
4 T C -1.2242
5 A C 0.0000
6 T C -0.8910
7 C C -1.0462
8 A C 0.0000
9 T C 0.0000
10 Q C -0.4177
11 R C -0.8310
12 L C 0.0000
13 A C 0.0000
14 N C -0.5782
15 F C 0.0000
16 L C -0.4690
17 V C 0.0000
18 R C -1.3958
19 S C -0.7933
20 S C 0.0000
21 N C -1.4475
22 N C -1.2107
23 L C 0.6176
24 G C -0.0708
25 P C -0.3372
26 V C -0.0446
27 L C 0.0000
28 P C -1.0389
29 P C -0.9472
30 T C -1.0864
31 N C -1.3377
32 V C -0.8556
33 G C -1.1545
34 S C -1.3021
35 N C -1.3595
36 T C -0.3848
37 Y C 0.5254
1 K D -2.0129
2 C D -1.7729
3 N D -1.9515
4 T D -1.2198
5 A D 0.0000
6 T D -0.9595
7 C D -0.9192
8 A D 0.0000
9 T D 0.0000
10 Q D -0.8844
11 R D -1.0564
12 L D 0.0000
13 A D 0.0000
14 N D -1.4289
15 F D 0.0000
16 L D -0.6250
17 V D -1.3527
18 R D -1.7242
19 S D 0.0000
20 S D 0.0000
21 N D -1.7974
22 N D -1.2245
23 L D 0.6124
24 G D -0.1907
25 P D -0.6691
26 V D -0.3487
27 L D 0.0000
28 P D -1.0743
29 P D -1.2467
30 T D -1.1011
31 N D -1.6239
32 V D -1.1709
33 G D -1.3743
34 S D -1.5723
35 N D -1.7515
36 T D -0.6540
37 Y D 0.5933
1 K E -1.9384
2 C E -1.6878
3 N E -1.9236
4 T E -0.9591
5 A E 0.0000
6 T E -0.8960
7 C E -0.7090
8 A E 0.0000
9 T E 0.0000
10 Q E -0.6410
11 R E -0.8809
12 L E 0.0000
13 A E 0.0000
14 N E -1.4568
15 F E 0.0000
16 L E -0.8110
17 V E -1.4772
18 R E -2.2638
19 S E 0.0000
20 S E 0.0000
21 N E -1.8648
22 N E -1.3830
23 L E 0.5984
24 G E -0.0823
25 P E -0.2786
26 V E 0.1118
27 L E -0.5011
28 P E -1.0515
29 P E -1.3565
30 T E -1.1968
31 N E -1.5145
32 V E -1.1279
33 G E -1.2718
34 S E -1.3126
35 N E -1.3553
36 T E -0.4293
37 Y E 0.5411
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018