Project name: query_structure

Status: done

Started: 2026-03-16 23:47:14
Settings
Chain sequence(s) A: GVPCGESCVYIPCFTGIINCSCRDKVCYNN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:15)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:15)
Show buried residues

Minimal score value
-2.8775
Maximal score value
2.9015
Average score
0.2709
Total score value
8.1281

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.4200
2 V A 1.0572
3 P A 0.1341
4 C A 0.3494
5 G A -0.2657
6 E A 0.1368
7 S A 0.2313
8 C A 0.7120
9 V A 1.7087
10 Y A 2.1806
11 I A 1.7565
12 P A 1.1250
13 C A 1.5046
14 F A 2.4939
15 T A 1.8690
16 G A 1.5739
17 I A 2.9015
18 I A 2.3724
19 N A -0.0743
20 C A 0.0000
21 S A -0.7350
22 C A -0.9389
23 R A -2.6203
24 D A -2.8775
25 K A -1.8282
26 V A -1.1251
27 C A 0.0000
28 Y A -0.9654
29 N A -0.7958
30 N A -1.3326
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018