Project name: 3f35e711f5597b4

Chain sequence(s)	A: QVQLVESGGGLVQPGGSLRLSCAASASSPSAKMLRWGWFRQAPGQGLEAVAQSEDEAKKIGIPNAKDPRFTISRDNSKNTLYLQMNSLRAEDTAVYYCADATLLDTEEQLAERGDWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:17)

• Minimal score value: -3.9605
• Maximal score value: 1.695
• Average score: -0.8842
• Total score value: -111.4149

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.5653
2	V	A	-0.9248
3	Q	A	-1.2920
4	L	A	0.0000
5	V	A	0.8741
6	E	A	0.3383
7	S	A	-0.2988
8	G	A	-0.8087
9	G	A	0.0898
10	G	A	0.6336
11	L	A	1.3284
12	V	A	0.0000
13	Q	A	-1.4637
14	P	A	-1.7317
15	G	A	-1.4774
16	G	A	-1.0177
17	S	A	-1.3917
18	L	A	-1.1517
19	R	A	-2.2925
20	L	A	0.0000
21	S	A	-0.5533
22	C	A	0.0000
23	A	A	-0.2335
24	A	A	-0.3694
25	S	A	-0.7051
26	A	A	-0.7469
27	S	A	-0.7752
28	S	A	-0.7733
29	P	A	-0.7258
30	S	A	-0.8428
31	A	A	-0.7957
32	K	A	-1.7992
33	M	A	-0.7798
34	L	A	-0.5274
35	R	A	-1.1053
36	W	A	0.0000
37	G	A	0.0000
38	W	A	0.0000
39	F	A	0.0000
40	R	A	-0.3069
41	Q	A	-0.7178
42	A	A	-1.0175
43	P	A	-1.1943
44	G	A	-1.2703
45	Q	A	-1.7872
46	G	A	-1.0975
47	L	A	-0.3290
48	E	A	-0.8982
49	A	A	-0.7915
50	V	A	0.0000
51	A	A	0.0000
52	Q	A	-1.5459
53	S	A	-1.0459
54	E	A	-1.5587
55	D	A	-2.2039
56	E	A	-2.5989
57	A	A	-1.8992
58	K	A	-2.5629
59	K	A	-1.8572
60	I	A	0.7747
61	G	A	-0.2078
62	I	A	1.3758
63	P	A	-0.1626
64	N	A	-1.5953
65	A	A	-1.5683
66	K	A	-2.3828
67	D	A	-1.4504
68	P	A	-1.0956
69	R	A	-1.0175
70	F	A	0.0000
71	T	A	-1.2469
72	I	A	0.0000
73	S	A	-0.6553
74	R	A	-1.6339
75	D	A	-2.0885
76	N	A	-2.4823
77	S	A	-1.9957
78	K	A	-2.6525
79	N	A	-2.0390
80	T	A	0.0000
81	L	A	0.0000
82	Y	A	-0.8219
83	L	A	0.0000
84	Q	A	-1.6577
85	M	A	0.0000
86	N	A	-1.4518
87	S	A	-1.2296
88	L	A	0.0000
89	R	A	-2.5222
90	A	A	-1.8467
91	E	A	-2.3248
92	D	A	0.0000
93	T	A	-0.4915
94	A	A	0.0000
95	V	A	0.8057
96	Y	A	0.0000
97	Y	A	0.2839
98	C	A	0.0000
99	A	A	0.0000
100	D	A	0.0000
101	A	A	-0.7939
102	T	A	-0.0174
103	L	A	0.8751
104	L	A	-1.3351
105	D	A	-2.1395
106	T	A	-2.3516
107	E	A	-3.4495
108	E	A	-3.9605
109	Q	A	-3.4124
110	L	A	0.0000
111	A	A	-2.5964
112	E	A	-3.7065
113	R	A	-3.1034
114	G	A	-2.0112
115	D	A	-1.7014
116	W	A	-0.5763
117	G	A	-0.4284
118	Q	A	-0.9402
119	G	A	0.0062
120	T	A	0.5537
121	L	A	1.6950
122	V	A	0.0000
123	T	A	0.3013
124	V	A	0.0000
125	S	A	-0.8410
126	S	A	-0.5337