Project name: 40b9c1500409f36

Status: done

Started: 2026-04-27 00:44:46
Settings
Chain sequence(s) A: QAWPNCFAGHGNYSAGSTYENNLLDLLRTLRQNASSSPALFASGTLGAAPDTAWALVLCRVDVSASDCYDCVTSPGQDAATACNRSRDVGLSYDQCYVRLANHNDFLDPNGNSGEVNHFSDLKITSNDVDGYNRAVTGLLSATVQYAVENSTRLFATGQWVGPDPGFSNIYSAAQCAADLSPMQCRSCLQGLVGKWWSTFSRDVMAARLAGPRCTLRSELDQFYNGDAMLLLPT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:49)
Show buried residues

Minimal score value
-2.7985
Maximal score value
1.2948
Average score
-0.6564
Total score value
-153.5967

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.2385
2 A A -0.6049
3 W A -0.4340
4 P A -0.3427
5 N A -0.2617
6 C A 0.2277
7 F A 0.3069
8 A A -0.2614
9 G A -0.8542
10 H A -1.1969
11 G A -1.5524
12 N A -2.2523
13 Y A 0.0000
14 S A -0.9373
15 A A -0.7611
16 G A -0.9118
17 S A -0.8465
18 T A -0.9599
19 Y A 0.0000
20 E A -1.2763
21 N A -1.6569
22 N A -1.1134
23 L A 0.0000
24 L A -0.8235
25 D A -1.6134
26 L A 0.0000
27 L A 0.0000
28 R A -2.3242
29 T A -1.6752
30 L A 0.0000
31 R A -1.9094
32 Q A -2.0194
33 N A -1.9542
34 A A 0.0000
35 S A -1.0444
36 S A -0.8846
37 S A -0.6529
38 P A -0.5586
39 A A -0.6596
40 L A 0.0000
41 F A -0.3441
42 A A 0.0000
43 S A -0.3929
44 G A -0.1695
45 T A -0.0012
46 L A 0.1169
47 G A -0.4297
48 A A -0.1512
49 A A -0.2369
50 P A -0.4621
51 D A -0.7162
52 T A -0.3069
53 A A 0.0000
54 W A -0.3388
55 A A 0.0000
56 L A 0.0000
57 V A 0.0000
58 L A 0.0000
59 C A 0.0000
60 R A -0.4521
61 V A -0.3481
62 D A -0.7873
63 V A -0.6637
64 S A -0.5777
65 A A -0.6428
66 S A -0.8482
67 D A -1.3973
68 C A 0.0000
69 Y A -1.3447
70 D A -1.9440
71 C A -1.2265
72 V A 0.0000
73 T A -1.0885
74 S A -0.8782
75 P A 0.0000
76 G A 0.0000
77 Q A -1.3562
78 D A -1.2311
79 A A 0.0000
80 A A -1.4707
81 T A -1.0022
82 A A -0.6640
83 C A 0.0000
84 N A -1.8471
85 R A -1.9991
86 S A -1.4961
87 R A -1.3212
88 D A 0.0000
89 V A 0.0000
90 G A 0.0000
91 L A 0.0000
92 S A 0.0000
93 Y A -0.5790
94 D A -0.8524
95 Q A -1.0653
96 C A 0.0000
97 Y A 0.0000
98 V A 0.0000
99 R A 0.0000
100 L A 0.0000
101 A A 0.0000
102 N A -1.1130
103 H A -1.2619
104 N A -2.0406
105 D A -2.6974
106 F A 0.0000
107 L A -1.7388
108 D A -2.4663
109 P A -1.9247
110 N A -1.8187
111 G A -1.6790
112 N A -1.1406
113 S A -1.0838
114 G A 0.0000
115 E A -0.7754
116 V A 0.0000
117 N A -1.1314
118 H A -0.3373
119 F A 0.7473
120 S A -0.0707
121 D A -1.1687
122 L A 0.0667
123 K A -1.5890
124 I A 0.0000
125 T A -0.8006
126 S A -1.4483
127 N A -1.9057
128 D A -1.9106
129 V A -1.5262
130 D A -1.9754
131 G A -1.5822
132 Y A 0.0000
133 N A 0.0000
134 R A -2.1154
135 A A 0.0000
136 V A 0.0000
137 T A -0.7983
138 G A -0.7687
139 L A 0.0000
140 L A 0.0000
141 S A -0.6959
142 A A -0.2515
143 T A 0.0000
144 V A 0.0000
145 Q A -2.2463
146 Y A -1.1265
147 A A 0.0000
148 V A 0.0000
149 E A -2.7985
150 N A -2.3760
151 S A -1.6727
152 T A -1.3977
153 R A -1.8948
154 L A 0.0000
155 F A 0.0000
156 A A 0.0000
157 T A 0.0000
158 G A 0.0000
159 Q A 0.2799
160 W A 0.6645
161 V A 0.7285
162 G A -0.1059
163 P A -0.4746
164 D A -0.9800
165 P A -0.6686
166 G A -0.9142
167 F A 0.0000
168 S A -0.3733
169 N A -0.7646
170 I A 0.0000
171 Y A -0.3567
172 S A 0.0000
173 A A 0.0000
174 A A 0.0000
175 Q A 0.0000
176 C A 0.0000
177 A A 0.0000
178 A A -1.1729
179 D A -1.9542
180 L A 0.0000
181 S A -0.6043
182 P A -0.9777
183 M A -0.1834
184 Q A -1.1821
185 C A 0.0000
186 R A -2.5097
187 S A -1.6732
188 C A -1.3625
189 L A 0.0000
190 Q A -2.2947
191 G A -1.5515
192 L A 0.0000
193 V A -0.8198
194 G A -1.1564
195 K A -1.0706
196 W A 0.0000
197 W A -0.5140
198 S A -0.5816
199 T A -0.5414
200 F A 0.0000
201 S A -1.0612
202 R A -1.6493
203 D A -1.6488
204 V A 0.0000
205 M A -0.4658
206 A A -0.0725
207 A A 0.0000
208 R A 0.0000
209 L A 0.0000
210 A A 0.0000
211 G A 0.0000
212 P A 0.0000
213 R A 0.0000
214 C A 0.0000
215 T A -0.0885
216 L A 0.0000
217 R A 0.0000
218 S A 0.0000
219 E A -0.5972
220 L A -0.9551
221 D A -2.0820
222 Q A -2.0103
223 F A -1.0385
224 Y A 0.0000
225 N A -2.0150
226 G A -1.9883
227 D A -2.0684
228 A A -0.5655
229 M A 0.3724
230 L A 0.8764
231 L A 1.2948
232 L A 0.7669
233 P A 0.3136
234 T A 0.2783
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018