Project name: 62_rank

Status: done

Started: 2026-05-18 11:34:41
Settings
Chain sequence(s) B: PSRPVLLHMARNRIEREAYRTGDPQLVHWAFYPDDPETRARLEELAEEIRREMEA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:05)
Show buried residues

Minimal score value
-4.0926
Maximal score value
1.9535
Average score
-1.6254
Total score value
-89.3952

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 P B -0.5834
2 S B -0.9664
3 R B -2.3398
4 P B -0.9463
5 V B 0.1604
6 L B 0.0000
7 L B -1.8714
8 H B -1.3621
9 M B -0.9960
10 A B 0.0000
11 R B -2.2030
12 N B -2.6626
13 R B -2.9578
14 I B 0.0000
15 E B -2.4648
16 R B -3.2159
17 E B -2.4340
18 A B 0.0000
19 Y B -0.7226
20 R B -2.1419
21 T B -1.3540
22 G B -1.3091
23 D B -1.3530
24 P B -1.1158
25 Q B -1.1470
26 L B -0.9065
27 V B 0.1053
28 H B -0.1885
29 W B -0.4097
30 A B 0.1206
31 F B 1.9535
32 Y B 1.0030
33 P B -0.6164
34 D B -1.9158
35 D B -1.7804
36 P B -2.0770
37 E B -2.7240
38 T B 0.0000
39 R B -3.1509
40 A B -2.8588
41 R B -2.9875
42 L B 0.0000
43 E B -4.0290
44 E B -3.7594
45 L B -2.9886
46 A B 0.0000
47 E B -4.0726
48 E B -3.7303
49 I B -2.9673
50 R B -3.3847
51 R B -4.0926
52 E B -3.4837
53 M B -1.9745
54 E B -2.7232
55 A B -1.7697
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018