Project name: 414e0a65e1529d3

Chain sequence(s)	A: MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKFLRSEELRQRLMSESEAASESRSPSAAAMGPETSKKIKLLPKGDLTDIGDKGVNLSGGQGPGPGVSAYSFSITAYFPEGGPGPGALQLMGGTPRSVDGPAAYVLFSGTLRFGPGPGIQHTVRNEF
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:21)

• Minimal score value: -3.7611
• Maximal score value: 5.8718
• Average score: -0.142
• Total score value: -27.4147

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	1.4276
2	R	A	0.5893
3	V	A	2.8035
4	L	A	3.2389
5	Y	A	3.4103
6	L	A	3.5784
7	L	A	4.0414
8	F	A	4.4015
9	S	A	4.4222
10	F	A	5.2206
11	L	A	5.3215
12	F	A	5.7786
13	I	A	5.8718
14	F	A	5.4900
15	L	A	4.9232
16	M	A	3.9719
17	P	A	2.1180
18	L	A	2.5026
19	P	A	0.9970
20	G	A	1.2658
21	V	A	2.4406
22	F	A	2.2685
23	G	A	0.6270
24	G	A	0.1477
25	I	A	0.1434
26	G	A	-0.6013
27	D	A	-0.3764
28	P	A	0.5985
29	V	A	1.5096
30	T	A	0.1830
31	C	A	0.0000
32	L	A	1.2646
33	K	A	-0.5783
34	S	A	-0.2125
35	G	A	-0.6716
36	A	A	0.0000
37	I	A	0.7874
38	C	A	0.9383
39	H	A	0.4184
40	P	A	0.9023
41	V	A	2.1803
42	F	A	1.9519
43	C	A	-0.2260
44	P	A	-1.3311
45	R	A	-2.7665
46	R	A	-3.3375
47	Y	A	-2.6302
48	K	A	-2.7207
49	Q	A	-1.6158
50	I	A	-0.7239
51	G	A	-0.8672
52	T	A	-0.7671
53	C	A	0.0000
54	G	A	-0.2419
55	L	A	0.6914
56	P	A	0.2296
57	G	A	0.3530
58	T	A	0.5294
59	K	A	-0.1400
60	C	A	0.0000
61	C	A	0.0000
62	K	A	-2.0444
63	K	A	-3.2562
64	P	A	-2.6221
65	E	A	-2.6915
66	A	A	-1.2175
67	A	A	-0.4946
68	K	A	-1.1288
69	F	A	1.5184
70	L	A	0.7524
71	R	A	-1.8700
72	S	A	-1.9877
73	E	A	-3.7611
74	E	A	-3.5439
75	L	A	-1.3454
76	R	A	-3.0134
77	Q	A	-3.3377
78	R	A	-2.9736
79	L	A	-1.2021
80	M	A	-1.4009
81	S	A	-2.1697
82	E	A	-2.5771
83	S	A	-1.8603
84	E	A	-2.5139
85	A	A	-1.8545
86	A	A	-1.6228
87	S	A	-2.1132
88	E	A	-2.6898
89	S	A	-2.1255
90	R	A	-2.5768
91	S	A	-1.3769
92	P	A	-0.9720
93	S	A	-0.5553
94	A	A	0.0396
95	A	A	0.2985
96	A	A	0.4875
97	M	A	0.5966
98	G	A	-0.5954
99	P	A	-1.6206
100	E	A	-2.7751
101	T	A	-2.0158
102	S	A	-2.2587
103	K	A	-3.2877
104	K	A	-2.7334
105	I	A	-1.8696
106	K	A	-2.4052
107	L	A	-0.3388
108	L	A	-0.5347
109	P	A	-0.7236
110	K	A	-1.9038
111	G	A	-1.9101
112	D	A	-1.7286
113	L	A	-0.2038
114	T	A	-1.4110
115	D	A	-1.8370
116	I	A	-0.8656
117	G	A	-1.5342
118	D	A	-2.6088
119	K	A	-2.3245
120	G	A	-1.2189
121	V	A	-0.0908
122	N	A	-0.8843
123	L	A	0.2932
124	S	A	-0.1914
125	G	A	-0.2266
126	G	A	-0.4661
127	Q	A	-1.3459
128	G	A	-0.8157
129	P	A	-0.2153
130	G	A	-0.4914
131	P	A	-0.2702
132	G	A	0.1005
133	V	A	1.4490
134	S	A	0.7387
135	A	A	1.2018
136	Y	A	1.6770
137	S	A	1.0175
138	F	A	2.1334
139	S	A	1.4927
140	I	A	2.4302
141	T	A	1.3931
142	A	A	1.4599
143	Y	A	1.7927
144	F	A	0.9540
145	P	A	-0.5392
146	E	A	-1.8673
147	G	A	-1.5132
148	G	A	-0.9711
149	P	A	-0.5779
150	G	A	-0.4239
151	P	A	0.1322
152	G	A	0.7403
153	A	A	1.1315
154	L	A	1.6440
155	Q	A	0.0605
156	L	A	1.3012
157	M	A	1.0094
158	G	A	0.0228
159	G	A	-0.4919
160	T	A	-0.6528
161	P	A	-0.9651
162	R	A	-1.9035
163	S	A	-0.8380
164	V	A	0.1574
165	D	A	-1.4564
166	G	A	-0.9822
167	P	A	-0.7104
168	A	A	-0.3998
169	A	A	0.6936
170	Y	A	1.7383
171	V	A	2.0735
172	L	A	1.8106
173	F	A	1.8475
174	S	A	-0.2577
175	G	A	-0.4974
176	T	A	-0.5729
177	L	A	-0.5004
178	R	A	-1.4945
179	F	A	-0.2316
180	G	A	-0.6068
181	P	A	-0.6522
182	G	A	-0.6936
183	P	A	-0.5278
184	G	A	-0.2084
185	I	A	0.8600
186	Q	A	-0.8523
187	H	A	-0.4360
188	T	A	-0.7293
189	V	A	0.0000
190	R	A	-1.9628
191	N	A	-1.6840
192	E	A	-1.9430
193	F	A	0.5495