Project name: query_structure

Chain sequence(s)	A: QVQLVESGGGSVQAGGSLRLSCAASGSISSITYLGWFRQAPGKEREGVAALNTNSGYTYYADSVKGRFTVSLDNAKNTVYLQMNSLKPEDTALYYCAAAFHGDYMPLWWILYGYWGQGTQVTV
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:58)

• Minimal score value: -3.6806
• Maximal score value: 2.7751
• Average score: -0.5976
• Total score value: -73.5057

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.3249
2	V	A	-0.6590
3	Q	A	-1.1227
4	L	A	0.0000
5	V	A	0.5742
6	E	A	0.0000
7	S	A	-0.6771
8	G	A	-1.1901
9	G	A	-1.1735
10	G	A	-0.8552
11	S	A	-0.5565
12	V	A	-0.5146
13	Q	A	-1.3131
14	A	A	-1.3791
15	G	A	-1.2672
16	G	A	-1.0062
17	S	A	-1.3005
18	L	A	-1.1672
19	R	A	-2.1583
20	L	A	0.0000
21	S	A	-0.3847
22	C	A	0.0000
23	A	A	-0.3761
24	A	A	0.0000
25	S	A	-0.6804
26	G	A	-0.7398
27	S	A	-0.8077
28	I	A	0.0000
29	S	A	-0.8965
30	S	A	-0.5099
31	I	A	0.0000
32	T	A	-0.6614
33	Y	A	-0.0119
34	L	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	F	A	0.0000
38	R	A	-1.4587
39	Q	A	-2.2351
40	A	A	-2.0794
41	P	A	-1.4640
42	G	A	-1.9901
43	K	A	-3.4034
44	E	A	-3.6806
45	R	A	-3.0201
46	E	A	-1.8944
47	G	A	-0.5614
48	V	A	0.0000
49	A	A	0.0000
50	A	A	0.0000
51	L	A	0.0000
52	N	A	0.0000
53	T	A	-0.7867
54	N	A	-1.4582
55	S	A	-0.6984
56	G	A	-0.3430
57	Y	A	0.5931
58	T	A	0.5598
59	Y	A	0.2613
60	Y	A	-0.7287
61	A	A	0.0000
62	D	A	-2.3999
63	S	A	-1.7932
64	V	A	0.0000
65	K	A	-2.5678
66	G	A	-1.8511
67	R	A	-1.6894
68	F	A	0.0000
69	T	A	-0.9485
70	V	A	0.0000
71	S	A	-0.3037
72	L	A	-0.6130
73	D	A	-1.5915
74	N	A	-2.1687
75	A	A	-1.6573
76	K	A	-2.3974
77	N	A	-1.8862
78	T	A	0.0000
79	V	A	0.0000
80	Y	A	-0.5182
81	L	A	0.0000
82	Q	A	-1.5083
83	M	A	0.0000
84	N	A	-1.9022
85	S	A	-1.3633
86	L	A	0.0000
87	K	A	-2.1299
88	P	A	-1.6976
89	E	A	-2.2400
90	D	A	0.0000
91	T	A	-1.0385
92	A	A	0.0000
93	L	A	-0.6965
94	Y	A	0.0000
95	Y	A	-0.3864
96	C	A	0.0000
97	A	A	0.0000
98	A	A	0.0000
99	A	A	0.0000
100	F	A	-0.3501
101	H	A	-1.3236
102	G	A	-0.9777
103	D	A	-0.6102
104	Y	A	1.0499
105	M	A	1.8263
106	P	A	1.4316
107	L	A	2.5892
108	W	A	2.1425
109	W	A	2.2076
110	I	A	2.7751
111	L	A	1.7157
112	Y	A	0.0000
113	G	A	0.1643
114	Y	A	0.2277
115	W	A	0.2592
116	G	A	-0.1769
117	Q	A	-0.9912
118	G	A	-0.6538
119	T	A	0.0000
120	Q	A	-1.3251
121	V	A	0.0000
122	T	A	-0.7546
123	V	A	-0.8356