Project name: query_structure

Status: done

Started: 2026-03-17 00:55:52
Settings
Chain sequence(s) A: QVQLVESGGGSVQAGGSLRLSCAASGSISSITYLGWFRQAPGKEREGVAALNTNSGYTYYADSVKGRFTVSLDNAKNTVYLQMNSLKPEDTALYYCAAAFHGDYMPLWWILYGYWGQGTQVTV
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:58)
Show buried residues

Minimal score value
-3.6806
Maximal score value
2.7751
Average score
-0.5976
Total score value
-73.5057

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.3249
2 V A -0.6590
3 Q A -1.1227
4 L A 0.0000
5 V A 0.5742
6 E A 0.0000
7 S A -0.6771
8 G A -1.1901
9 G A -1.1735
10 G A -0.8552
11 S A -0.5565
12 V A -0.5146
13 Q A -1.3131
14 A A -1.3791
15 G A -1.2672
16 G A -1.0062
17 S A -1.3005
18 L A -1.1672
19 R A -2.1583
20 L A 0.0000
21 S A -0.3847
22 C A 0.0000
23 A A -0.3761
24 A A 0.0000
25 S A -0.6804
26 G A -0.7398
27 S A -0.8077
28 I A 0.0000
29 S A -0.8965
30 S A -0.5099
31 I A 0.0000
32 T A -0.6614
33 Y A -0.0119
34 L A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A 0.0000
38 R A -1.4587
39 Q A -2.2351
40 A A -2.0794
41 P A -1.4640
42 G A -1.9901
43 K A -3.4034
44 E A -3.6806
45 R A -3.0201
46 E A -1.8944
47 G A -0.5614
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 L A 0.0000
52 N A 0.0000
53 T A -0.7867
54 N A -1.4582
55 S A -0.6984
56 G A -0.3430
57 Y A 0.5931
58 T A 0.5598
59 Y A 0.2613
60 Y A -0.7287
61 A A 0.0000
62 D A -2.3999
63 S A -1.7932
64 V A 0.0000
65 K A -2.5678
66 G A -1.8511
67 R A -1.6894
68 F A 0.0000
69 T A -0.9485
70 V A 0.0000
71 S A -0.3037
72 L A -0.6130
73 D A -1.5915
74 N A -2.1687
75 A A -1.6573
76 K A -2.3974
77 N A -1.8862
78 T A 0.0000
79 V A 0.0000
80 Y A -0.5182
81 L A 0.0000
82 Q A -1.5083
83 M A 0.0000
84 N A -1.9022
85 S A -1.3633
86 L A 0.0000
87 K A -2.1299
88 P A -1.6976
89 E A -2.2400
90 D A 0.0000
91 T A -1.0385
92 A A 0.0000
93 L A -0.6965
94 Y A 0.0000
95 Y A -0.3864
96 C A 0.0000
97 A A 0.0000
98 A A 0.0000
99 A A 0.0000
100 F A -0.3501
101 H A -1.3236
102 G A -0.9777
103 D A -0.6102
104 Y A 1.0499
105 M A 1.8263
106 P A 1.4316
107 L A 2.5892
108 W A 2.1425
109 W A 2.2076
110 I A 2.7751
111 L A 1.7157
112 Y A 0.0000
113 G A 0.1643
114 Y A 0.2277
115 W A 0.2592
116 G A -0.1769
117 Q A -0.9912
118 G A -0.6538
119 T A 0.0000
120 Q A -1.3251
121 V A 0.0000
122 T A -0.7546
123 V A -0.8356
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018