Project name: ag-h1-1(1)

Chain sequence(s)	A: QLQLVESGGKLVQAGGSLRLSCAASGRSVNNYFMGWFRQAPGKEREFVARITWNGAGTYYADSVKGRFTISVDNAKNTVNLQMNSLKPEDTALYYCAARRTDSRRPLFEYDYRGQGTQVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:21)

• Minimal score value: -3.6218
• Maximal score value: 0.9573
• Average score: -0.9994
• Total score value: -122.9253

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-2.0167
2	L	A	0.0000
3	Q	A	-1.8683
4	L	A	0.0000
5	V	A	0.6026
6	E	A	0.0000
7	S	A	-0.7374
8	G	A	-1.6221
9	G	A	-1.6035
10	K	A	-1.6375
11	L	A	0.2212
12	V	A	0.0000
13	Q	A	-1.3156
14	A	A	-1.4270
15	G	A	-1.2986
16	G	A	-1.1044
17	S	A	-1.4524
18	L	A	0.0000
19	R	A	-2.6836
20	L	A	0.0000
21	S	A	-0.5960
22	C	A	0.0000
23	A	A	-0.1644
24	A	A	0.0000
25	S	A	-1.3296
26	G	A	-2.0751
27	R	A	-2.9606
28	S	A	-2.0088
29	V	A	0.0000
30	N	A	-2.0885
31	N	A	-2.5124
32	Y	A	0.0000
33	F	A	-0.4220
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	F	A	0.0000
38	R	A	0.0000
39	Q	A	-2.2275
40	A	A	-2.0361
41	P	A	-1.4525
42	G	A	-1.9804
43	K	A	-3.3793
44	E	A	-3.6218
45	R	A	-2.9432
46	E	A	-1.9724
47	F	A	0.0000
48	V	A	0.0000
49	A	A	0.0000
50	R	A	0.3288
51	I	A	0.0000
52	T	A	-0.3899
53	W	A	-0.9345
54	N	A	-1.5770
55	G	A	-0.8968
56	A	A	-0.4703
57	G	A	-0.1802
58	T	A	0.3607
59	Y	A	0.5475
60	Y	A	-0.4503
61	A	A	-1.2194
62	D	A	-2.3915
63	S	A	-1.7589
64	V	A	0.0000
65	K	A	-2.5011
66	G	A	-1.7779
67	R	A	-1.6376
68	F	A	0.0000
69	T	A	-0.9915
70	I	A	0.0000
71	S	A	-0.5536
72	V	A	-0.7799
73	D	A	-1.3770
74	N	A	-1.7401
75	A	A	-1.2511
76	K	A	-2.0896
77	N	A	-1.7772
78	T	A	-0.8351
79	V	A	0.0000
80	N	A	-0.9642
81	L	A	0.0000
82	Q	A	-1.8796
83	M	A	0.0000
84	N	A	-1.5535
85	S	A	-1.1617
86	L	A	0.0000
87	K	A	-2.1097
88	P	A	-1.7826
89	E	A	-2.2353
90	D	A	0.0000
91	T	A	-1.0831
92	A	A	0.0000
93	L	A	-0.7242
94	Y	A	0.0000
95	Y	A	0.0000
96	C	A	0.0000
97	A	A	0.0000
98	A	A	0.0000
99	R	A	-1.7522
100	R	A	-2.6741
101	T	A	-1.8933
102	D	A	-2.5793
103	S	A	-2.5799
104	R	A	-3.0400
105	R	A	-2.6671
106	P	A	-0.6797
107	L	A	0.9573
108	F	A	0.8276
109	E	A	-0.8986
110	Y	A	-1.0209
111	D	A	-1.7925
112	Y	A	-1.4565
113	R	A	-1.8491
114	G	A	-1.1168
115	Q	A	-1.3677
116	G	A	-0.9291
117	T	A	-1.0301
118	Q	A	-1.4819
119	V	A	0.0000
120	T	A	-0.7207
121	V	A	0.0000
122	S	A	-0.7948
123	S	A	-0.8346