| Chain sequence(s) |
M: NFNVYKATRPYLAHCPDCGEGHSCHSPIALERIRNEATDGTLKNQVSLQIGIKTDDSHDWTKLRYMDSHTPADAERAGLLVRTSAPCTNTGTMGHFILARCPKGETLTVGFTDSRKISHTCTHPFHHEPPVIGRERFHSRPQHGKELPCSTSVQSTAATAEEIEVHMPPDTPDRTLMTQQSGNVKNTVNGQTVRYKCNCGGSNEGLTTTDKVINNCKIDQCHAAVTNHKNWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVKMLLYPDHPTLLSYRNMGQEPNYHEEWVTHKKEVTKTVPTEGLEVTWGNNEPYKYWPQMSTNGTAHGHPHEIIQYYYELYPTMTQVNQSVASSVLESMVGTAKGMCVCARRRCITPYELTPGATVPFELSQKCCA
input PDB |
| Selected Chain(s) | M |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:00)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:00)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with M chain(s) selected (00:00:00)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:00)
[INFO] FoldX: Starting FoldX energy minimalization (00:00:00)
[INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:05:08)
[INFO] Auto_mut: Residue number 377 from chain M and a score of 2.290 (valine) selected for
automated muatation (00:05:11)
[INFO] Auto_mut: Residue number 378 from chain M and a score of 2.060 (leucine) selected for
automated muatation (00:05:11)
[INFO] Auto_mut: Residue number 381 from chain M and a score of 1.536 (methionine) selected
for automated muatation (00:05:11)
[INFO] Auto_mut: Residue number 359 from chain M and a score of 1.494 (tyrosine) selected
for automated muatation (00:05:11)
[INFO] Auto_mut: Residue number 373 from chain M and a score of 1.471 (valine) selected for
automated muatation (00:05:11)
[INFO] Auto_mut: Residue number 84 from chain M and a score of 1.238 (leucine) selected for
automated muatation (00:05:11)
[INFO] Auto_mut: Residue number 363 from chain M and a score of 1.173 (tyrosine) selected
for automated muatation (00:05:11)
[INFO] Auto_mut: Residue number 382 from chain M and a score of 1.159 (valine) selected for
automated muatation (00:05:11)
[INFO] Auto_mut: Residue number 366 from chain M and a score of 1.137 (methionine) selected
for automated muatation (00:05:11)
[INFO] Auto_mut: Residue number 276 from chain M and a score of 1.126 (valine) selected for
automated muatation (00:05:11)
[INFO] Auto_mut: Mutating residue number 377 from chain M (valine) into glutamic acid (00:05:11)
[INFO] Auto_mut: Mutating residue number 378 from chain M (leucine) into glutamic acid (00:05:11)
[INFO] Auto_mut: Mutating residue number 381 from chain M (methionine) into glutamic acid (00:05:11)
[INFO] Auto_mut: Mutating residue number 381 from chain M (methionine) into lysine (00:07:36)
[INFO] Auto_mut: Mutating residue number 377 from chain M (valine) into lysine (00:07:40)
[INFO] Auto_mut: Mutating residue number 378 from chain M (leucine) into lysine (00:07:41)
[INFO] Auto_mut: Mutating residue number 381 from chain M (methionine) into aspartic acid (00:10:07)
[INFO] Auto_mut: Mutating residue number 378 from chain M (leucine) into aspartic acid (00:10:09)
[INFO] Auto_mut: Mutating residue number 377 from chain M (valine) into aspartic acid (00:10:10)
[INFO] Auto_mut: Mutating residue number 378 from chain M (leucine) into arginine (00:12:24)
[INFO] Auto_mut: Mutating residue number 381 from chain M (methionine) into arginine (00:12:25)
[INFO] Auto_mut: Mutating residue number 377 from chain M (valine) into arginine (00:12:25)
[INFO] Auto_mut: Mutating residue number 359 from chain M (tyrosine) into glutamic acid (00:14:38)
[INFO] Auto_mut: Mutating residue number 373 from chain M (valine) into glutamic acid (00:14:40)
[INFO] Auto_mut: Mutating residue number 84 from chain M (leucine) into glutamic acid (00:14:41)
[INFO] Auto_mut: Mutating residue number 359 from chain M (tyrosine) into lysine (00:16:55)
[INFO] Auto_mut: Mutating residue number 373 from chain M (valine) into lysine (00:16:56)
[INFO] Auto_mut: Mutating residue number 84 from chain M (leucine) into lysine (00:16:58)
[INFO] Auto_mut: Mutating residue number 373 from chain M (valine) into aspartic acid (00:19:16)
[INFO] Auto_mut: Mutating residue number 359 from chain M (tyrosine) into aspartic acid (00:19:28)
[INFO] Auto_mut: Mutating residue number 84 from chain M (leucine) into aspartic acid (00:19:31)
[INFO] Auto_mut: Mutating residue number 373 from chain M (valine) into arginine (00:21:32)
[INFO] Auto_mut: Mutating residue number 359 from chain M (tyrosine) into arginine (00:21:46)
[INFO] Auto_mut: Mutating residue number 84 from chain M (leucine) into arginine (00:21:47)
[INFO] Auto_mut: Mutating residue number 363 from chain M (tyrosine) into glutamic acid (00:24:03)
[INFO] Auto_mut: Mutating residue number 382 from chain M (valine) into glutamic acid (00:24:21)
[INFO] Auto_mut: Mutating residue number 366 from chain M (methionine) into glutamic acid (00:24:24)
[INFO] Auto_mut: Mutating residue number 363 from chain M (tyrosine) into lysine (00:26:29)
[INFO] Auto_mut: Mutating residue number 382 from chain M (valine) into lysine (00:26:46)
[INFO] Auto_mut: Mutating residue number 366 from chain M (methionine) into lysine (00:26:54)
[INFO] Auto_mut: Mutating residue number 363 from chain M (tyrosine) into aspartic acid (00:28:58)
[INFO] Auto_mut: Mutating residue number 382 from chain M (valine) into aspartic acid (00:29:20)
[INFO] Auto_mut: Mutating residue number 366 from chain M (methionine) into aspartic acid (00:29:30)
[INFO] Auto_mut: Mutating residue number 363 from chain M (tyrosine) into arginine (00:31:22)
[INFO] Auto_mut: Mutating residue number 382 from chain M (valine) into arginine (00:31:48)
[INFO] Auto_mut: Mutating residue number 366 from chain M (methionine) into arginine (00:31:56)
[INFO] Auto_mut: Mutating residue number 276 from chain M (valine) into glutamic acid (00:33:46)
[INFO] Auto_mut: Mutating residue number 276 from chain M (valine) into lysine (00:36:04)
[INFO] Auto_mut: Mutating residue number 276 from chain M (valine) into aspartic acid (00:38:31)
[INFO] Auto_mut: Mutating residue number 276 from chain M (valine) into arginine (00:40:42)
[INFO] Auto_mut: Effect of mutation residue number 377 from chain M (valine) into glutamic
acid: Energy difference: -0.2010 kcal/mol, Difference in average score from
the base case: -0.0303 (00:42:59)
[INFO] Auto_mut: Effect of mutation residue number 377 from chain M (valine) into lysine:
Energy difference: -0.3904 kcal/mol, Difference in average score from the
base case: -0.0307 (00:42:59)
[INFO] Auto_mut: Effect of mutation residue number 377 from chain M (valine) into aspartic
acid: Energy difference: 0.2957 kcal/mol, Difference in average score from
the base case: -0.0295 (00:42:59)
[INFO] Auto_mut: Effect of mutation residue number 377 from chain M (valine) into arginine:
Energy difference: -0.5213 kcal/mol, Difference in average score from the
base case: -0.0331 (00:42:59)
[INFO] Auto_mut: Effect of mutation residue number 378 from chain M (leucine) into glutamic
acid: Energy difference: 0.5894 kcal/mol, Difference in average score from
the base case: -0.0259 (00:42:59)
[INFO] Auto_mut: Effect of mutation residue number 378 from chain M (leucine) into lysine:
Energy difference: 0.1817 kcal/mol, Difference in average score from the
base case: -0.0281 (00:42:59)
[INFO] Auto_mut: Effect of mutation residue number 378 from chain M (leucine) into aspartic
acid: Energy difference: 1.0490 kcal/mol, Difference in average score from
the base case: -0.0256 (00:42:59)
[INFO] Auto_mut: Effect of mutation residue number 378 from chain M (leucine) into arginine:
Energy difference: 0.0735 kcal/mol, Difference in average score from the
base case: -0.0269 (00:42:59)
[INFO] Auto_mut: Effect of mutation residue number 381 from chain M (methionine) into
glutamic acid: Energy difference: 0.6344 kcal/mol, Difference in average
score from the base case: -0.0238 (00:42:59)
[INFO] Auto_mut: Effect of mutation residue number 381 from chain M (methionine) into
lysine: Energy difference: 0.2873 kcal/mol, Difference in average score
from the base case: -0.0243 (00:42:59)
[INFO] Auto_mut: Effect of mutation residue number 381 from chain M (methionine) into
aspartic acid: Energy difference: 1.0048 kcal/mol, Difference in average
score from the base case: -0.0224 (00:42:59)
[INFO] Auto_mut: Effect of mutation residue number 381 from chain M (methionine) into
arginine: Energy difference: 0.5273 kcal/mol, Difference in average score
from the base case: -0.0286 (00:42:59)
[INFO] Auto_mut: Effect of mutation residue number 359 from chain M (tyrosine) into glutamic
acid: Energy difference: 0.5023 kcal/mol, Difference in average score from
the base case: -0.0130 (00:42:59)
[INFO] Auto_mut: Effect of mutation residue number 359 from chain M (tyrosine) into lysine:
Energy difference: -0.1406 kcal/mol, Difference in average score from the
base case: -0.0130 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 359 from chain M (tyrosine) into aspartic
acid: Energy difference: 1.5534 kcal/mol, Difference in average score from
the base case: -0.0139 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 359 from chain M (tyrosine) into
arginine: Energy difference: 0.1577 kcal/mol, Difference in average score
from the base case: -0.0184 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 373 from chain M (valine) into glutamic
acid: Energy difference: -0.0039 kcal/mol, Difference in average score from
the base case: -0.0303 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 373 from chain M (valine) into lysine:
Energy difference: -0.1818 kcal/mol, Difference in average score from the
base case: -0.0335 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 373 from chain M (valine) into aspartic
acid: Energy difference: 0.3303 kcal/mol, Difference in average score from
the base case: -0.0325 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 373 from chain M (valine) into arginine:
Energy difference: -0.2509 kcal/mol, Difference in average score from the
base case: -0.0361 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 84 from chain M (leucine) into glutamic
acid: Energy difference: -0.2107 kcal/mol, Difference in average score from
the base case: -0.0327 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 84 from chain M (leucine) into lysine:
Energy difference: -0.0047 kcal/mol, Difference in average score from the
base case: -0.0321 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 84 from chain M (leucine) into aspartic
acid: Energy difference: 0.1554 kcal/mol, Difference in average score from
the base case: -0.0312 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 84 from chain M (leucine) into arginine:
Energy difference: 0.0970 kcal/mol, Difference in average score from the
base case: -0.0380 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 363 from chain M (tyrosine) into glutamic
acid: Energy difference: 0.7644 kcal/mol, Difference in average score from
the base case: -0.0134 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 363 from chain M (tyrosine) into lysine:
Energy difference: 0.3720 kcal/mol, Difference in average score from the
base case: -0.0126 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 363 from chain M (tyrosine) into aspartic
acid: Energy difference: 1.5478 kcal/mol, Difference in average score from
the base case: -0.0105 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 363 from chain M (tyrosine) into
arginine: Energy difference: 0.8372 kcal/mol, Difference in average score
from the base case: -0.0230 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 382 from chain M (valine) into glutamic
acid: Energy difference: -0.2121 kcal/mol, Difference in average score from
the base case: -0.0311 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 382 from chain M (valine) into lysine:
Energy difference: -0.2584 kcal/mol, Difference in average score from the
base case: -0.0353 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 382 from chain M (valine) into aspartic
acid: Energy difference: 0.0462 kcal/mol, Difference in average score from
the base case: -0.0299 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 382 from chain M (valine) into arginine:
Energy difference: -0.7362 kcal/mol, Difference in average score from the
base case: -0.0353 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 366 from chain M (methionine) into
glutamic acid: Energy difference: 0.3242 kcal/mol, Difference in average
score from the base case: -0.0142 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 366 from chain M (methionine) into
lysine: Energy difference: 0.8031 kcal/mol, Difference in average score
from the base case: -0.0178 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 366 from chain M (methionine) into
aspartic acid: Energy difference: -0.3347 kcal/mol, Difference in average
score from the base case: -0.0127 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 366 from chain M (methionine) into
arginine: Energy difference: 1.1833 kcal/mol, Difference in average score
from the base case: -0.0240 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 276 from chain M (valine) into glutamic
acid: Energy difference: 1.3153 kcal/mol, Difference in average score from
the base case: -0.0204 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 276 from chain M (valine) into lysine:
Energy difference: 0.0984 kcal/mol, Difference in average score from the
base case: -0.0159 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 276 from chain M (valine) into aspartic
acid: Energy difference: 1.7671 kcal/mol, Difference in average score from
the base case: -0.0195 (00:43:00)
[INFO] Auto_mut: Effect of mutation residue number 276 from chain M (valine) into arginine:
Energy difference: 0.1916 kcal/mol, Difference in average score from the
base case: -0.0193 (00:43:00)
[INFO] Main: Simulation completed successfully. (00:43:10)
|
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan3D score | mutation |
|---|---|---|---|---|
| residue index | residue name | chain | Aggrescan3D score | |
| 5 | N | M | -1.4528 | |
| 6 | F | M | -1.3367 | |
| 7 | N | M | -1.8110 | |
| 8 | V | M | -0.5241 | |
| 9 | Y | M | 0.0000 | |
| 10 | K | M | -2.2849 | |
| 11 | A | M | -1.3096 | |
| 12 | T | M | -0.8081 | |
| 13 | R | M | -0.7963 | |
| 14 | P | M | 0.0000 | |
| 15 | Y | M | 0.0000 | |
| 16 | L | M | 0.2016 | |
| 17 | A | M | 0.0000 | |
| 18 | H | M | -1.1141 | |
| 19 | C | M | 0.0000 | |
| 20 | P | M | -1.3055 | |
| 21 | D | M | -1.9809 | |
| 22 | C | M | -1.6110 | |
| 23 | G | M | -1.8621 | |
| 24 | E | M | -2.6804 | |
| 25 | G | M | -2.1846 | |
| 26 | H | M | -2.0912 | |
| 27 | S | M | -1.6301 | |
| 28 | C | M | -1.0219 | |
| 29 | H | M | -1.1819 | |
| 30 | S | M | 0.0000 | |
| 31 | P | M | -0.3875 | |
| 32 | I | M | 0.0000 | |
| 33 | A | M | 0.0000 | |
| 34 | L | M | 0.0000 | |
| 35 | E | M | -1.4823 | |
| 36 | R | M | -2.4677 | |
| 37 | I | M | -2.0454 | |
| 38 | R | M | -3.3511 | |
| 39 | N | M | -3.4640 | |
| 40 | E | M | -3.0600 | |
| 41 | A | M | -2.0113 | |
| 42 | T | M | -1.3680 | |
| 43 | D | M | -2.1568 | |
| 44 | G | M | -2.2899 | |
| 45 | T | M | -2.0206 | |
| 46 | L | M | 0.0000 | |
| 47 | K | M | -1.7331 | |
| 48 | N | M | 0.0000 | |
| 49 | Q | M | -0.9734 | |
| 50 | V | M | 0.0000 | |
| 51 | S | M | 0.0000 | |
| 52 | L | M | 0.0000 | |
| 53 | Q | M | 0.0000 | |
| 54 | I | M | 0.0000 | |
| 55 | G | M | 0.0000 | |
| 56 | I | M | 0.0000 | |
| 57 | K | M | -1.9569 | |
| 58 | T | M | -2.0674 | |
| 59 | D | M | -2.7395 | |
| 60 | D | M | -2.8729 | |
| 61 | S | M | -2.0599 | |
| 62 | H | M | -1.9177 | |
| 63 | D | M | -1.0914 | |
| 64 | W | M | -0.2025 | |
| 65 | T | M | -0.8529 | |
| 66 | K | M | -1.7629 | |
| 67 | L | M | 0.0000 | |
| 68 | R | M | 0.0000 | |
| 69 | Y | M | 0.0000 | |
| 70 | M | M | -0.8131 | |
| 71 | D | M | -1.6677 | |
| 72 | S | M | -1.1106 | |
| 73 | H | M | -1.1672 | |
| 74 | T | M | -0.9423 | |
| 75 | P | M | -1.0182 | |
| 76 | A | M | -1.0230 | |
| 77 | D | M | -2.0137 | |
| 78 | A | M | -2.1284 | |
| 79 | E | M | -2.4881 | |
| 80 | R | M | -1.3853 | |
| 81 | A | M | -0.6127 | |
| 82 | G | M | -0.3251 | |
| 83 | L | M | 0.5142 | |
| 84 | L | M | 1.2378 | |
| 85 | V | M | 0.0505 | |
| 86 | R | M | -1.1069 | |
| 87 | T | M | 0.0000 | |
| 88 | S | M | -1.2535 | |
| 89 | A | M | -0.7158 | |
| 90 | P | M | -0.7479 | |
| 91 | C | M | -0.8714 | |
| 92 | T | M | -0.9513 | |
| 93 | N | M | -0.9630 | |
| 94 | T | M | -0.9610 | |
| 95 | G | M | -0.5554 | |
| 96 | T | M | -0.2374 | |
| 97 | M | M | 0.0000 | |
| 98 | G | M | 0.0000 | |
| 99 | H | M | -0.1634 | |
| 100 | F | M | 0.0000 | |
| 101 | I | M | 0.0000 | |
| 102 | L | M | 0.0000 | |
| 103 | A | M | 0.0000 | |
| 104 | R | M | -2.3679 | |
| 105 | C | M | -1.6308 | |
| 106 | P | M | -1.7923 | |
| 107 | K | M | -2.8949 | |
| 108 | G | M | -2.6047 | |
| 109 | E | M | -2.8714 | |
| 110 | T | M | -1.6763 | |
| 111 | L | M | 0.0000 | |
| 112 | T | M | -0.3425 | |
| 113 | V | M | 0.0000 | |
| 114 | G | M | 0.2070 | |
| 115 | F | M | 0.0000 | |
| 116 | T | M | -0.7459 | |
| 117 | D | M | -1.6225 | |
| 118 | S | M | -1.8953 | |
| 119 | R | M | -2.3355 | |
| 120 | K | M | -1.8971 | |
| 121 | I | M | 0.2028 | |
| 122 | S | M | -0.1713 | |
| 123 | H | M | -0.0532 | |
| 124 | T | M | -0.2242 | |
| 125 | C | M | 0.0000 | |
| 126 | T | M | -0.6472 | |
| 127 | H | M | -0.8319 | |
| 128 | P | M | -0.9583 | |
| 129 | F | M | -0.9907 | |
| 130 | H | M | -2.3310 | |
| 131 | H | M | -2.6481 | |
| 132 | E | M | -2.7349 | |
| 133 | P | M | -1.6295 | |
| 134 | P | M | -0.3615 | |
| 135 | V | M | 0.8286 | |
| 136 | I | M | 0.2127 | |
| 137 | G | M | -0.8138 | |
| 138 | R | M | -1.1625 | |
| 139 | E | M | 0.0000 | |
| 140 | R | M | -1.7962 | |
| 141 | F | M | -1.2243 | |
| 142 | H | M | -1.5824 | |
| 143 | S | M | -1.7543 | |
| 144 | R | M | -2.8640 | |
| 145 | P | M | -2.5986 | |
| 146 | Q | M | -2.5383 | |
| 147 | H | M | -2.6848 | |
| 148 | G | M | -3.1221 | |
| 149 | K | M | -3.0972 | |
| 150 | E | M | -3.0275 | |
| 151 | L | M | -1.2902 | |
| 152 | P | M | -0.8001 | |
| 153 | C | M | -0.8433 | |
| 154 | S | M | -0.7291 | |
| 155 | T | M | -0.6417 | |
| 156 | S | M | -0.2289 | |
| 157 | V | M | 0.1741 | |
| 158 | Q | M | -0.8409 | |
| 159 | S | M | -0.5204 | |
| 160 | T | M | -0.4872 | |
| 161 | A | M | -0.3896 | |
| 162 | A | M | -0.5680 | |
| 163 | T | M | -0.7630 | |
| 164 | A | M | -1.1782 | |
| 165 | E | M | -2.3962 | |
| 166 | E | M | -2.5453 | |
| 167 | I | M | -1.6788 | |
| 168 | E | M | -2.4584 | |
| 169 | V | M | 0.0000 | |
| 170 | H | M | -2.5881 | |
| 171 | M | M | -1.7963 | |
| 172 | P | M | 0.0000 | |
| 173 | P | M | -2.0176 | |
| 174 | D | M | -2.8057 | |
| 175 | T | M | -1.4894 | |
| 176 | P | M | -1.6420 | |
| 177 | D | M | -1.6463 | |
| 178 | R | M | -2.2105 | |
| 179 | T | M | -0.9943 | |
| 180 | L | M | -0.8629 | |
| 181 | M | M | -0.9602 | |
| 182 | T | M | -1.4571 | |
| 183 | Q | M | -2.4356 | |
| 184 | Q | M | -2.3600 | |
| 185 | S | M | -1.8809 | |
| 186 | G | M | -2.1937 | |
| 187 | N | M | -2.0960 | |
| 188 | V | M | 0.0000 | |
| 189 | K | M | -0.9560 | |
| 190 | N | M | 0.0000 | |
| 191 | T | M | -1.0189 | |
| 192 | V | M | 0.0000 | |
| 193 | N | M | -1.8138 | |
| 194 | G | M | -1.2384 | |
| 195 | Q | M | -1.1545 | |
| 196 | T | M | -0.8414 | |
| 197 | V | M | 0.0000 | |
| 198 | R | M | -2.3652 | |
| 199 | Y | M | 0.0000 | |
| 200 | K | M | -2.9754 | |
| 201 | C | M | 0.0000 | |
| 202 | N | M | -2.8224 | |
| 203 | C | M | -2.2870 | |
| 204 | G | M | -1.5485 | |
| 205 | G | M | -1.3325 | |
| 206 | S | M | -2.1048 | |
| 207 | N | M | -2.7244 | |
| 208 | E | M | -3.0015 | |
| 209 | G | M | -1.2527 | |
| 210 | L | M | 0.2516 | |
| 211 | T | M | -0.4390 | |
| 212 | T | M | -0.8171 | |
| 213 | T | M | -1.3300 | |
| 214 | D | M | -2.1628 | |
| 215 | K | M | -0.9959 | |
| 216 | V | M | 0.5404 | |
| 217 | I | M | -0.5590 | |
| 218 | N | M | -1.8994 | |
| 219 | N | M | -2.4883 | |
| 220 | C | M | -2.5901 | |
| 221 | K | M | -3.1804 | |
| 222 | I | M | -2.0579 | |
| 223 | D | M | -2.9513 | |
| 224 | Q | M | -2.8734 | |
| 225 | C | M | -2.4506 | |
| 226 | H | M | -2.5307 | |
| 227 | A | M | 0.0000 | |
| 228 | A | M | 0.0000 | |
| 229 | V | M | -1.4205 | |
| 230 | T | M | -1.5805 | |
| 231 | N | M | -2.3462 | |
| 232 | H | M | -1.9936 | |
| 233 | K | M | -2.1631 | |
| 234 | N | M | -1.5414 | |
| 235 | W | M | -1.1630 | |
| 236 | Q | M | -0.5283 | |
| 237 | Y | M | -0.4778 | |
| 238 | N | M | -1.2991 | |
| 239 | S | M | 0.0000 | |
| 240 | P | M | -0.2491 | |
| 241 | L | M | 0.3269 | |
| 242 | V | M | -0.2761 | |
| 243 | P | M | -1.5212 | |
| 244 | R | M | -3.0120 | |
| 245 | N | M | -3.0416 | |
| 246 | A | M | -1.9328 | |
| 247 | E | M | -1.9787 | |
| 248 | L | M | -0.6428 | |
| 249 | G | M | -2.3321 | |
| 250 | D | M | -3.2744 | |
| 251 | R | M | -3.7224 | |
| 252 | K | M | -3.2096 | |
| 253 | G | M | -2.0734 | |
| 254 | K | M | -2.0780 | |
| 255 | I | M | 0.0000 | |
| 256 | H | M | -1.3927 | |
| 257 | I | M | -0.7852 | |
| 258 | P | M | 0.0000 | |
| 259 | F | M | 0.0000 | |
| 260 | P | M | 0.1892 | |
| 261 | L | M | 0.6616 | |
| 262 | A | M | 0.2030 | |
| 263 | N | M | -0.6908 | |
| 264 | V | M | -0.0440 | |
| 265 | T | M | -0.8984 | |
| 266 | C | M | -1.8574 | |
| 267 | R | M | -3.4988 | |
| 268 | V | M | 0.0000 | |
| 269 | P | M | -2.7583 | |
| 270 | K | M | -2.5162 | |
| 271 | A | M | -2.1580 | |
| 272 | R | M | -2.8753 | |
| 273 | N | M | -2.0679 | |
| 274 | P | M | -0.6499 | |
| 275 | T | M | -0.0800 | |
| 276 | V | M | 1.1260 | |
| 277 | T | M | 0.7715 | |
| 278 | Y | M | 0.5191 | |
| 279 | G | M | -1.1583 | |
| 280 | K | M | -2.3337 | |
| 281 | N | M | -2.0696 | |
| 282 | Q | M | -1.6657 | |
| 283 | V | M | 0.0000 | |
| 284 | K | M | -0.7778 | |
| 285 | M | M | 0.0000 | |
| 286 | L | M | -0.7412 | |
| 287 | L | M | 0.0000 | |
| 288 | Y | M | -1.3681 | |
| 289 | P | M | -1.8160 | |
| 290 | D | M | -2.5238 | |
| 291 | H | M | -1.6918 | |
| 292 | P | M | -1.0103 | |
| 293 | T | M | 0.0000 | |
| 294 | L | M | -0.6229 | |
| 295 | L | M | 0.0000 | |
| 296 | S | M | -0.9365 | |
| 297 | Y | M | -0.7315 | |
| 298 | R | M | -1.1642 | |
| 299 | N | M | -1.6430 | |
| 300 | M | M | -1.7645 | |
| 301 | G | M | -2.0279 | |
| 302 | Q | M | -2.6381 | |
| 303 | E | M | -2.8271 | |
| 304 | P | M | -1.8354 | |
| 305 | N | M | -1.6591 | |
| 306 | Y | M | -0.5708 | |
| 307 | H | M | -1.8496 | |
| 308 | E | M | -2.3779 | |
| 309 | E | M | -1.7372 | |
| 310 | W | M | -0.0553 | |
| 311 | V | M | 0.0000 | |
| 312 | T | M | -1.0741 | |
| 313 | H | M | -2.1939 | |
| 314 | K | M | -2.9042 | |
| 315 | K | M | -2.5273 | |
| 316 | E | M | -2.4361 | |
| 317 | V | M | -1.0645 | |
| 318 | T | M | -0.8514 | |
| 319 | K | M | -0.6673 | |
| 320 | T | M | -1.0622 | |
| 321 | V | M | 0.0000 | |
| 322 | P | M | -0.7231 | |
| 323 | T | M | -0.9527 | |
| 324 | E | M | -1.6034 | |
| 325 | G | M | 0.0000 | |
| 326 | L | M | 0.0000 | |
| 327 | E | M | -0.9556 | |
| 328 | V | M | 0.0000 | |
| 329 | T | M | -0.7534 | |
| 330 | W | M | 0.0000 | |
| 331 | G | M | 0.0000 | |
| 332 | N | M | 0.0000 | |
| 333 | N | M | -1.9939 | |
| 334 | E | M | -1.9487 | |
| 335 | P | M | -1.4226 | |
| 336 | Y | M | -1.1226 | |
| 337 | K | M | -1.4218 | |
| 338 | Y | M | -0.4160 | |
| 339 | W | M | 0.0578 | |
| 340 | P | M | -0.6735 | |
| 341 | Q | M | -0.8676 | |
| 342 | M | M | 0.0123 | |
| 343 | S | M | -0.7278 | |
| 344 | T | M | -1.0046 | |
| 345 | N | M | -1.8641 | |
| 346 | G | M | -1.1743 | |
| 347 | T | M | -0.8621 | |
| 348 | A | M | -0.4384 | |
| 349 | H | M | -1.4610 | |
| 350 | G | M | -1.7079 | |
| 351 | H | M | -1.7531 | |
| 352 | P | M | -1.2760 | |
| 353 | H | M | -1.3411 | |
| 354 | E | M | -1.3987 | |
| 355 | I | M | 0.0642 | |
| 356 | I | M | 0.8387 | |
| 357 | Q | M | -0.5116 | |
| 358 | Y | M | 0.0612 | |
| 359 | Y | M | 1.4939 | |
| 360 | Y | M | 0.9436 | |
| 361 | E | M | -0.8284 | |
| 362 | L | M | 0.6044 | |
| 363 | Y | M | 1.1727 | |
| 364 | P | M | 0.4562 | |
| 365 | T | M | 0.4778 | |
| 366 | M | M | 1.1374 | |
| 367 | T | M | 0.2919 | |
| 368 | Q | M | -0.2320 | |
| 369 | V | M | 0.7445 | |
| 370 | N | M | -0.6930 | |
| 371 | Q | M | -0.9514 | |
| 372 | S | M | -0.0432 | |
| 373 | V | M | 1.4710 | |
| 374 | A | M | 0.7789 | |
| 375 | S | M | 0.2086 | |
| 376 | S | M | 0.7566 | |
| 377 | V | M | 2.2898 | |
| 378 | L | M | 2.0601 | |
| 379 | E | M | -0.1368 | |
| 380 | S | M | 0.6511 | |
| 381 | M | M | 1.5365 | |
| 382 | V | M | 1.1593 | |
| 383 | G | M | -0.2173 | |
| 384 | T | M | -0.0802 | |
| 385 | A | M | 0.1377 | |
| 386 | K | M | -0.8193 | |
| 387 | G | M | 0.0419 | |
| 388 | M | M | 0.8843 | |
| 389 | C | M | 0.3759 | |
| 390 | V | M | 0.3586 | |
| 391 | C | M | 0.0141 | |
| 392 | A | M | -0.5127 | |
| 393 | R | M | -1.2640 | |
| 394 | R | M | -2.5704 | |
| 395 | R | M | -2.5997 | |
| 396 | C | M | -1.1530 | |
| 397 | I | M | -0.7966 | |
| 398 | T | M | -1.2632 | |
| 399 | P | M | -0.4768 | |
| 400 | Y | M | 0.1345 | |
| 401 | E | M | -0.8568 | |
| 402 | L | M | 0.6363 | |
| 403 | T | M | 0.0371 | |
| 404 | P | M | -0.3367 | |
| 405 | G | M | -0.5540 | |
| 406 | A | M | -0.1645 | |
| 407 | T | M | 0.1287 | |
| 408 | V | M | 0.5098 | |
| 409 | P | M | 0.5578 | |
| 410 | F | M | 0.8010 | |
| 411 | E | M | -1.1469 | |
| 412 | L | M | -0.3669 | |
| 413 | S | M | -0.3811 | |
| 414 | Q | M | -1.6799 | |
| 415 | K | M | -2.0121 | |
| 416 | C | M | -0.5140 | |
| 417 | C | M | -0.8099 | |
| 418 | A | M | -0.8247 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
| VR382M | -0.7362 | -0.0353 | View | CSV | PDB |
| VR377M | -0.5213 | -0.0331 | View | CSV | PDB |
| VK377M | -0.3904 | -0.0307 | View | CSV | PDB |
| VR373M | -0.2509 | -0.0361 | View | CSV | PDB |
| VK382M | -0.2584 | -0.0353 | View | CSV | PDB |
| LE84M | -0.2107 | -0.0327 | View | CSV | PDB |
| VK373M | -0.1818 | -0.0335 | View | CSV | PDB |
| LK84M | -0.0047 | -0.0321 | View | CSV | PDB |
| MD366M | -0.3347 | -0.0127 | View | CSV | PDB |
| YK359M | -0.1406 | -0.013 | View | CSV | PDB |
| LR378M | 0.0735 | -0.0269 | View | CSV | PDB |
| VK276M | 0.0984 | -0.0159 | View | CSV | PDB |
| LK378M | 0.1817 | -0.0281 | View | CSV | PDB |
| YR359M | 0.1577 | -0.0184 | View | CSV | PDB |
| VR276M | 0.1916 | -0.0193 | View | CSV | PDB |
| MK381M | 0.2873 | -0.0243 | View | CSV | PDB |
| MR381M | 0.5273 | -0.0286 | View | CSV | PDB |
| ME366M | 0.3242 | -0.0142 | View | CSV | PDB |
| YK363M | 0.372 | -0.0126 | View | CSV | PDB |
| YR363M | 0.8372 | -0.023 | View | CSV | PDB |