Project name: Mut-4

Status: done

Started: 2024-06-25 17:34:47
Settings
Chain sequence(s) M: NFNVYKATRPYLAHCPDCGEGHSCHSPIALERIRNEATDGTLKNQVSLQIGIKTDDSHDWTKLRYMDSHTPADAERAGLLVRTSAPCTNTGTMGHFILARCPKGETLTVGFTDSRKISHTCTHPFHHEPPVIGRERFHSRPQHGKELPCSTSVQSTAATAEEIEVHMPPDTPDRTLMTQQSGNVKNTVNGQTVRYKCNCGGSNEGLTTTDKVINNCKIDQCHAAVTNHKNWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVKMLLYPDHPTLLSYRNMGQEPNYHEEWVTHKKEVTKTVPTEGLEVTWGNNEPYKYWPQMSTNGTAHGHPHEIIQYYYELYPTMTQVNQSVASSVLESMVGTAKGMCVCARRRCITPYELTPGATVPFELSQKCCA
input PDB
Selected Chain(s) M
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations Yes
Downloads Download all the data
Simulation log 
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with M chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:08)
[INFO]       Auto_mut: Residue number 377 from chain M and a score of 2.290 (valine) selected for  
                       automated muatation                                                         (00:05:11)
[INFO]       Auto_mut: Residue number 378 from chain M and a score of 2.060 (leucine) selected for 
                       automated muatation                                                         (00:05:11)
[INFO]       Auto_mut: Residue number 381 from chain M and a score of 1.536 (methionine) selected  
                       for automated muatation                                                     (00:05:11)
[INFO]       Auto_mut: Residue number 359 from chain M and a score of 1.494 (tyrosine) selected    
                       for automated muatation                                                     (00:05:11)
[INFO]       Auto_mut: Residue number 373 from chain M and a score of 1.471 (valine) selected for  
                       automated muatation                                                         (00:05:11)
[INFO]       Auto_mut: Residue number 84 from chain M and a score of 1.238 (leucine) selected for  
                       automated muatation                                                         (00:05:11)
[INFO]       Auto_mut: Residue number 363 from chain M and a score of 1.173 (tyrosine) selected    
                       for automated muatation                                                     (00:05:11)
[INFO]       Auto_mut: Residue number 382 from chain M and a score of 1.159 (valine) selected for  
                       automated muatation                                                         (00:05:11)
[INFO]       Auto_mut: Residue number 366 from chain M and a score of 1.137 (methionine) selected  
                       for automated muatation                                                     (00:05:11)
[INFO]       Auto_mut: Residue number 276 from chain M and a score of 1.126 (valine) selected for  
                       automated muatation                                                         (00:05:11)
[INFO]       Auto_mut: Mutating residue number 377 from chain M (valine) into glutamic acid        (00:05:11)
[INFO]       Auto_mut: Mutating residue number 378 from chain M (leucine) into glutamic acid       (00:05:11)
[INFO]       Auto_mut: Mutating residue number 381 from chain M (methionine) into glutamic acid    (00:05:11)
[INFO]       Auto_mut: Mutating residue number 381 from chain M (methionine) into lysine           (00:07:36)
[INFO]       Auto_mut: Mutating residue number 377 from chain M (valine) into lysine               (00:07:40)
[INFO]       Auto_mut: Mutating residue number 378 from chain M (leucine) into lysine              (00:07:41)
[INFO]       Auto_mut: Mutating residue number 381 from chain M (methionine) into aspartic acid    (00:10:07)
[INFO]       Auto_mut: Mutating residue number 378 from chain M (leucine) into aspartic acid       (00:10:09)
[INFO]       Auto_mut: Mutating residue number 377 from chain M (valine) into aspartic acid        (00:10:10)
[INFO]       Auto_mut: Mutating residue number 378 from chain M (leucine) into arginine            (00:12:24)
[INFO]       Auto_mut: Mutating residue number 381 from chain M (methionine) into arginine         (00:12:25)
[INFO]       Auto_mut: Mutating residue number 377 from chain M (valine) into arginine             (00:12:25)
[INFO]       Auto_mut: Mutating residue number 359 from chain M (tyrosine) into glutamic acid      (00:14:38)
[INFO]       Auto_mut: Mutating residue number 373 from chain M (valine) into glutamic acid        (00:14:40)
[INFO]       Auto_mut: Mutating residue number 84 from chain M (leucine) into glutamic acid        (00:14:41)
[INFO]       Auto_mut: Mutating residue number 359 from chain M (tyrosine) into lysine             (00:16:55)
[INFO]       Auto_mut: Mutating residue number 373 from chain M (valine) into lysine               (00:16:56)
[INFO]       Auto_mut: Mutating residue number 84 from chain M (leucine) into lysine               (00:16:58)
[INFO]       Auto_mut: Mutating residue number 373 from chain M (valine) into aspartic acid        (00:19:16)
[INFO]       Auto_mut: Mutating residue number 359 from chain M (tyrosine) into aspartic acid      (00:19:28)
[INFO]       Auto_mut: Mutating residue number 84 from chain M (leucine) into aspartic acid        (00:19:31)
[INFO]       Auto_mut: Mutating residue number 373 from chain M (valine) into arginine             (00:21:32)
[INFO]       Auto_mut: Mutating residue number 359 from chain M (tyrosine) into arginine           (00:21:46)
[INFO]       Auto_mut: Mutating residue number 84 from chain M (leucine) into arginine             (00:21:47)
[INFO]       Auto_mut: Mutating residue number 363 from chain M (tyrosine) into glutamic acid      (00:24:03)
[INFO]       Auto_mut: Mutating residue number 382 from chain M (valine) into glutamic acid        (00:24:21)
[INFO]       Auto_mut: Mutating residue number 366 from chain M (methionine) into glutamic acid    (00:24:24)
[INFO]       Auto_mut: Mutating residue number 363 from chain M (tyrosine) into lysine             (00:26:29)
[INFO]       Auto_mut: Mutating residue number 382 from chain M (valine) into lysine               (00:26:46)
[INFO]       Auto_mut: Mutating residue number 366 from chain M (methionine) into lysine           (00:26:54)
[INFO]       Auto_mut: Mutating residue number 363 from chain M (tyrosine) into aspartic acid      (00:28:58)
[INFO]       Auto_mut: Mutating residue number 382 from chain M (valine) into aspartic acid        (00:29:20)
[INFO]       Auto_mut: Mutating residue number 366 from chain M (methionine) into aspartic acid    (00:29:30)
[INFO]       Auto_mut: Mutating residue number 363 from chain M (tyrosine) into arginine           (00:31:22)
[INFO]       Auto_mut: Mutating residue number 382 from chain M (valine) into arginine             (00:31:48)
[INFO]       Auto_mut: Mutating residue number 366 from chain M (methionine) into arginine         (00:31:56)
[INFO]       Auto_mut: Mutating residue number 276 from chain M (valine) into glutamic acid        (00:33:46)
[INFO]       Auto_mut: Mutating residue number 276 from chain M (valine) into lysine               (00:36:04)
[INFO]       Auto_mut: Mutating residue number 276 from chain M (valine) into aspartic acid        (00:38:31)
[INFO]       Auto_mut: Mutating residue number 276 from chain M (valine) into arginine             (00:40:42)
[INFO]       Auto_mut: Effect of mutation residue number 377 from chain M (valine) into glutamic   
                       acid: Energy difference: -0.2010 kcal/mol, Difference in average score from 
                       the base case: -0.0303                                                      (00:42:59)
[INFO]       Auto_mut: Effect of mutation residue number 377 from chain M (valine) into lysine:    
                       Energy difference: -0.3904 kcal/mol, Difference in average score from the   
                       base case: -0.0307                                                          (00:42:59)
[INFO]       Auto_mut: Effect of mutation residue number 377 from chain M (valine) into aspartic   
                       acid: Energy difference: 0.2957 kcal/mol, Difference in average score from  
                       the base case: -0.0295                                                      (00:42:59)
[INFO]       Auto_mut: Effect of mutation residue number 377 from chain M (valine) into arginine:  
                       Energy difference: -0.5213 kcal/mol, Difference in average score from the   
                       base case: -0.0331                                                          (00:42:59)
[INFO]       Auto_mut: Effect of mutation residue number 378 from chain M (leucine) into glutamic  
                       acid: Energy difference: 0.5894 kcal/mol, Difference in average score from  
                       the base case: -0.0259                                                      (00:42:59)
[INFO]       Auto_mut: Effect of mutation residue number 378 from chain M (leucine) into lysine:   
                       Energy difference: 0.1817 kcal/mol, Difference in average score from the    
                       base case: -0.0281                                                          (00:42:59)
[INFO]       Auto_mut: Effect of mutation residue number 378 from chain M (leucine) into aspartic  
                       acid: Energy difference: 1.0490 kcal/mol, Difference in average score from  
                       the base case: -0.0256                                                      (00:42:59)
[INFO]       Auto_mut: Effect of mutation residue number 378 from chain M (leucine) into arginine: 
                       Energy difference: 0.0735 kcal/mol, Difference in average score from the    
                       base case: -0.0269                                                          (00:42:59)
[INFO]       Auto_mut: Effect of mutation residue number 381 from chain M (methionine) into        
                       glutamic acid: Energy difference: 0.6344 kcal/mol, Difference in average    
                       score from the base case: -0.0238                                           (00:42:59)
[INFO]       Auto_mut: Effect of mutation residue number 381 from chain M (methionine) into        
                       lysine: Energy difference: 0.2873 kcal/mol, Difference in average score     
                       from the base case: -0.0243                                                 (00:42:59)
[INFO]       Auto_mut: Effect of mutation residue number 381 from chain M (methionine) into        
                       aspartic acid: Energy difference: 1.0048 kcal/mol, Difference in average    
                       score from the base case: -0.0224                                           (00:42:59)
[INFO]       Auto_mut: Effect of mutation residue number 381 from chain M (methionine) into        
                       arginine: Energy difference: 0.5273 kcal/mol, Difference in average score   
                       from the base case: -0.0286                                                 (00:42:59)
[INFO]       Auto_mut: Effect of mutation residue number 359 from chain M (tyrosine) into glutamic 
                       acid: Energy difference: 0.5023 kcal/mol, Difference in average score from  
                       the base case: -0.0130                                                      (00:42:59)
[INFO]       Auto_mut: Effect of mutation residue number 359 from chain M (tyrosine) into lysine:  
                       Energy difference: -0.1406 kcal/mol, Difference in average score from the   
                       base case: -0.0130                                                          (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 359 from chain M (tyrosine) into aspartic 
                       acid: Energy difference: 1.5534 kcal/mol, Difference in average score from  
                       the base case: -0.0139                                                      (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 359 from chain M (tyrosine) into          
                       arginine: Energy difference: 0.1577 kcal/mol, Difference in average score   
                       from the base case: -0.0184                                                 (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 373 from chain M (valine) into glutamic   
                       acid: Energy difference: -0.0039 kcal/mol, Difference in average score from 
                       the base case: -0.0303                                                      (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 373 from chain M (valine) into lysine:    
                       Energy difference: -0.1818 kcal/mol, Difference in average score from the   
                       base case: -0.0335                                                          (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 373 from chain M (valine) into aspartic   
                       acid: Energy difference: 0.3303 kcal/mol, Difference in average score from  
                       the base case: -0.0325                                                      (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 373 from chain M (valine) into arginine:  
                       Energy difference: -0.2509 kcal/mol, Difference in average score from the   
                       base case: -0.0361                                                          (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 84 from chain M (leucine) into glutamic   
                       acid: Energy difference: -0.2107 kcal/mol, Difference in average score from 
                       the base case: -0.0327                                                      (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 84 from chain M (leucine) into lysine:    
                       Energy difference: -0.0047 kcal/mol, Difference in average score from the   
                       base case: -0.0321                                                          (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 84 from chain M (leucine) into aspartic   
                       acid: Energy difference: 0.1554 kcal/mol, Difference in average score from  
                       the base case: -0.0312                                                      (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 84 from chain M (leucine) into arginine:  
                       Energy difference: 0.0970 kcal/mol, Difference in average score from the    
                       base case: -0.0380                                                          (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 363 from chain M (tyrosine) into glutamic 
                       acid: Energy difference: 0.7644 kcal/mol, Difference in average score from  
                       the base case: -0.0134                                                      (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 363 from chain M (tyrosine) into lysine:  
                       Energy difference: 0.3720 kcal/mol, Difference in average score from the    
                       base case: -0.0126                                                          (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 363 from chain M (tyrosine) into aspartic 
                       acid: Energy difference: 1.5478 kcal/mol, Difference in average score from  
                       the base case: -0.0105                                                      (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 363 from chain M (tyrosine) into          
                       arginine: Energy difference: 0.8372 kcal/mol, Difference in average score   
                       from the base case: -0.0230                                                 (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 382 from chain M (valine) into glutamic   
                       acid: Energy difference: -0.2121 kcal/mol, Difference in average score from 
                       the base case: -0.0311                                                      (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 382 from chain M (valine) into lysine:    
                       Energy difference: -0.2584 kcal/mol, Difference in average score from the   
                       base case: -0.0353                                                          (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 382 from chain M (valine) into aspartic   
                       acid: Energy difference: 0.0462 kcal/mol, Difference in average score from  
                       the base case: -0.0299                                                      (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 382 from chain M (valine) into arginine:  
                       Energy difference: -0.7362 kcal/mol, Difference in average score from the   
                       base case: -0.0353                                                          (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 366 from chain M (methionine) into        
                       glutamic acid: Energy difference: 0.3242 kcal/mol, Difference in average    
                       score from the base case: -0.0142                                           (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 366 from chain M (methionine) into        
                       lysine: Energy difference: 0.8031 kcal/mol, Difference in average score     
                       from the base case: -0.0178                                                 (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 366 from chain M (methionine) into        
                       aspartic acid: Energy difference: -0.3347 kcal/mol, Difference in average   
                       score from the base case: -0.0127                                           (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 366 from chain M (methionine) into        
                       arginine: Energy difference: 1.1833 kcal/mol, Difference in average score   
                       from the base case: -0.0240                                                 (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 276 from chain M (valine) into glutamic   
                       acid: Energy difference: 1.3153 kcal/mol, Difference in average score from  
                       the base case: -0.0204                                                      (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 276 from chain M (valine) into lysine:    
                       Energy difference: 0.0984 kcal/mol, Difference in average score from the    
                       base case: -0.0159                                                          (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 276 from chain M (valine) into aspartic   
                       acid: Energy difference: 1.7671 kcal/mol, Difference in average score from  
                       the base case: -0.0195                                                      (00:43:00)
[INFO]       Auto_mut: Effect of mutation residue number 276 from chain M (valine) into arginine:  
                       Energy difference: 0.1916 kcal/mol, Difference in average score from the    
                       base case: -0.0193                                                          (00:43:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:43:10)
Show buried residues
Minimal score value
-3.7224
Maximal score value
2.2898
Average score
-1.0162
Total score value
-420.694
Download the table (csv)

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
5 N M -1.4528
6 F M -1.3367
7 N M -1.8110
8 V M -0.5241
9 Y M 0.0000
10 K M -2.2849
11 A M -1.3096
12 T M -0.8081
13 R M -0.7963
14 P M 0.0000
15 Y M 0.0000
16 L M 0.2016
17 A M 0.0000
18 H M -1.1141
19 C M 0.0000
20 P M -1.3055
21 D M -1.9809
22 C M -1.6110
23 G M -1.8621
24 E M -2.6804
25 G M -2.1846
26 H M -2.0912
27 S M -1.6301
28 C M -1.0219
29 H M -1.1819
30 S M 0.0000
31 P M -0.3875
32 I M 0.0000
33 A M 0.0000
34 L M 0.0000
35 E M -1.4823
36 R M -2.4677
37 I M -2.0454
38 R M -3.3511
39 N M -3.4640
40 E M -3.0600
41 A M -2.0113
42 T M -1.3680
43 D M -2.1568
44 G M -2.2899
45 T M -2.0206
46 L M 0.0000
47 K M -1.7331
48 N M 0.0000
49 Q M -0.9734
50 V M 0.0000
51 S M 0.0000
52 L M 0.0000
53 Q M 0.0000
54 I M 0.0000
55 G M 0.0000
56 I M 0.0000
57 K M -1.9569
58 T M -2.0674
59 D M -2.7395
60 D M -2.8729
61 S M -2.0599
62 H M -1.9177
63 D M -1.0914
64 W M -0.2025
65 T M -0.8529
66 K M -1.7629
67 L M 0.0000
68 R M 0.0000
69 Y M 0.0000
70 M M -0.8131
71 D M -1.6677
72 S M -1.1106
73 H M -1.1672
74 T M -0.9423
75 P M -1.0182
76 A M -1.0230
77 D M -2.0137
78 A M -2.1284
79 E M -2.4881
80 R M -1.3853
81 A M -0.6127
82 G M -0.3251
83 L M 0.5142
84 L M 1.2378
85 V M 0.0505
86 R M -1.1069
87 T M 0.0000
88 S M -1.2535
89 A M -0.7158
90 P M -0.7479
91 C M -0.8714
92 T M -0.9513
93 N M -0.9630
94 T M -0.9610
95 G M -0.5554
96 T M -0.2374
97 M M 0.0000
98 G M 0.0000
99 H M -0.1634
100 F M 0.0000
101 I M 0.0000
102 L M 0.0000
103 A M 0.0000
104 R M -2.3679
105 C M -1.6308
106 P M -1.7923
107 K M -2.8949
108 G M -2.6047
109 E M -2.8714
110 T M -1.6763
111 L M 0.0000
112 T M -0.3425
113 V M 0.0000
114 G M 0.2070
115 F M 0.0000
116 T M -0.7459
117 D M -1.6225
118 S M -1.8953
119 R M -2.3355
120 K M -1.8971
121 I M 0.2028
122 S M -0.1713
123 H M -0.0532
124 T M -0.2242
125 C M 0.0000
126 T M -0.6472
127 H M -0.8319
128 P M -0.9583
129 F M -0.9907
130 H M -2.3310
131 H M -2.6481
132 E M -2.7349
133 P M -1.6295
134 P M -0.3615
135 V M 0.8286
136 I M 0.2127
137 G M -0.8138
138 R M -1.1625
139 E M 0.0000
140 R M -1.7962
141 F M -1.2243
142 H M -1.5824
143 S M -1.7543
144 R M -2.8640
145 P M -2.5986
146 Q M -2.5383
147 H M -2.6848
148 G M -3.1221
149 K M -3.0972
150 E M -3.0275
151 L M -1.2902
152 P M -0.8001
153 C M -0.8433
154 S M -0.7291
155 T M -0.6417
156 S M -0.2289
157 V M 0.1741
158 Q M -0.8409
159 S M -0.5204
160 T M -0.4872
161 A M -0.3896
162 A M -0.5680
163 T M -0.7630
164 A M -1.1782
165 E M -2.3962
166 E M -2.5453
167 I M -1.6788
168 E M -2.4584
169 V M 0.0000
170 H M -2.5881
171 M M -1.7963
172 P M 0.0000
173 P M -2.0176
174 D M -2.8057
175 T M -1.4894
176 P M -1.6420
177 D M -1.6463
178 R M -2.2105
179 T M -0.9943
180 L M -0.8629
181 M M -0.9602
182 T M -1.4571
183 Q M -2.4356
184 Q M -2.3600
185 S M -1.8809
186 G M -2.1937
187 N M -2.0960
188 V M 0.0000
189 K M -0.9560
190 N M 0.0000
191 T M -1.0189
192 V M 0.0000
193 N M -1.8138
194 G M -1.2384
195 Q M -1.1545
196 T M -0.8414
197 V M 0.0000
198 R M -2.3652
199 Y M 0.0000
200 K M -2.9754
201 C M 0.0000
202 N M -2.8224
203 C M -2.2870
204 G M -1.5485
205 G M -1.3325
206 S M -2.1048
207 N M -2.7244
208 E M -3.0015
209 G M -1.2527
210 L M 0.2516
211 T M -0.4390
212 T M -0.8171
213 T M -1.3300
214 D M -2.1628
215 K M -0.9959
216 V M 0.5404
217 I M -0.5590
218 N M -1.8994
219 N M -2.4883
220 C M -2.5901
221 K M -3.1804
222 I M -2.0579
223 D M -2.9513
224 Q M -2.8734
225 C M -2.4506
226 H M -2.5307
227 A M 0.0000
228 A M 0.0000
229 V M -1.4205
230 T M -1.5805
231 N M -2.3462
232 H M -1.9936
233 K M -2.1631
234 N M -1.5414
235 W M -1.1630
236 Q M -0.5283
237 Y M -0.4778
238 N M -1.2991
239 S M 0.0000
240 P M -0.2491
241 L M 0.3269
242 V M -0.2761
243 P M -1.5212
244 R M -3.0120
245 N M -3.0416
246 A M -1.9328
247 E M -1.9787
248 L M -0.6428
249 G M -2.3321
250 D M -3.2744
251 R M -3.7224
252 K M -3.2096
253 G M -2.0734
254 K M -2.0780
255 I M 0.0000
256 H M -1.3927
257 I M -0.7852
258 P M 0.0000
259 F M 0.0000
260 P M 0.1892
261 L M 0.6616
262 A M 0.2030
263 N M -0.6908
264 V M -0.0440
265 T M -0.8984
266 C M -1.8574
267 R M -3.4988
268 V M 0.0000
269 P M -2.7583
270 K M -2.5162
271 A M -2.1580
272 R M -2.8753
273 N M -2.0679
274 P M -0.6499
275 T M -0.0800
276 V M 1.1260
277 T M 0.7715
278 Y M 0.5191
279 G M -1.1583
280 K M -2.3337
281 N M -2.0696
282 Q M -1.6657
283 V M 0.0000
284 K M -0.7778
285 M M 0.0000
286 L M -0.7412
287 L M 0.0000
288 Y M -1.3681
289 P M -1.8160
290 D M -2.5238
291 H M -1.6918
292 P M -1.0103
293 T M 0.0000
294 L M -0.6229
295 L M 0.0000
296 S M -0.9365
297 Y M -0.7315
298 R M -1.1642
299 N M -1.6430
300 M M -1.7645
301 G M -2.0279
302 Q M -2.6381
303 E M -2.8271
304 P M -1.8354
305 N M -1.6591
306 Y M -0.5708
307 H M -1.8496
308 E M -2.3779
309 E M -1.7372
310 W M -0.0553
311 V M 0.0000
312 T M -1.0741
313 H M -2.1939
314 K M -2.9042
315 K M -2.5273
316 E M -2.4361
317 V M -1.0645
318 T M -0.8514
319 K M -0.6673
320 T M -1.0622
321 V M 0.0000
322 P M -0.7231
323 T M -0.9527
324 E M -1.6034
325 G M 0.0000
326 L M 0.0000
327 E M -0.9556
328 V M 0.0000
329 T M -0.7534
330 W M 0.0000
331 G M 0.0000
332 N M 0.0000
333 N M -1.9939
334 E M -1.9487
335 P M -1.4226
336 Y M -1.1226
337 K M -1.4218
338 Y M -0.4160
339 W M 0.0578
340 P M -0.6735
341 Q M -0.8676
342 M M 0.0123
343 S M -0.7278
344 T M -1.0046
345 N M -1.8641
346 G M -1.1743
347 T M -0.8621
348 A M -0.4384
349 H M -1.4610
350 G M -1.7079
351 H M -1.7531
352 P M -1.2760
353 H M -1.3411
354 E M -1.3987
355 I M 0.0642
356 I M 0.8387
357 Q M -0.5116
358 Y M 0.0612
359 Y M 1.4939
360 Y M 0.9436
361 E M -0.8284
362 L M 0.6044
363 Y M 1.1727
364 P M 0.4562
365 T M 0.4778
366 M M 1.1374
367 T M 0.2919
368 Q M -0.2320
369 V M 0.7445
370 N M -0.6930
371 Q M -0.9514
372 S M -0.0432
373 V M 1.4710
374 A M 0.7789
375 S M 0.2086
376 S M 0.7566
377 V M 2.2898
378 L M 2.0601
379 E M -0.1368
380 S M 0.6511
381 M M 1.5365
382 V M 1.1593
383 G M -0.2173
384 T M -0.0802
385 A M 0.1377
386 K M -0.8193
387 G M 0.0419
388 M M 0.8843
389 C M 0.3759
390 V M 0.3586
391 C M 0.0141
392 A M -0.5127
393 R M -1.2640
394 R M -2.5704
395 R M -2.5997
396 C M -1.1530
397 I M -0.7966
398 T M -1.2632
399 P M -0.4768
400 Y M 0.1345
401 E M -0.8568
402 L M 0.6363
403 T M 0.0371
404 P M -0.3367
405 G M -0.5540
406 A M -0.1645
407 T M 0.1287
408 V M 0.5098
409 P M 0.5578
410 F M 0.8010
411 E M -1.1469
412 L M -0.3669
413 S M -0.3811
414 Q M -1.6799
415 K M -2.0121
416 C M -0.5140
417 C M -0.8099
418 A M -0.8247
Download PDB file
View in 3Dmol
Play the video

Automated mutations analysis

In the automated mutations mode, the server selects aggregation prone resides and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine. The table below shows 2 best scored mutants for each mutated residue. Protein variants are ordered according to the mutation effect they had on protein stability (energetic effect) together with the difference in the average per-residue aggregation score between the wild type and the mutant (in the table green values indicate a positive change, grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this CSV file.

Mutant
Energetic effect
Score comparison
VR382M -0.7362 -0.0353 View CSV PDB
VR377M -0.5213 -0.0331 View CSV PDB
VK377M -0.3904 -0.0307 View CSV PDB
VR373M -0.2509 -0.0361 View CSV PDB
VK382M -0.2584 -0.0353 View CSV PDB
LE84M -0.2107 -0.0327 View CSV PDB
VK373M -0.1818 -0.0335 View CSV PDB
LK84M -0.0047 -0.0321 View CSV PDB
MD366M -0.3347 -0.0127 View CSV PDB
YK359M -0.1406 -0.013 View CSV PDB
LR378M 0.0735 -0.0269 View CSV PDB
VK276M 0.0984 -0.0159 View CSV PDB
LK378M 0.1817 -0.0281 View CSV PDB
YR359M 0.1577 -0.0184 View CSV PDB
VR276M 0.1916 -0.0193 View CSV PDB
MK381M 0.2873 -0.0243 View CSV PDB
MR381M 0.5273 -0.0286 View CSV PDB
ME366M 0.3242 -0.0142 View CSV PDB
YK363M 0.372 -0.0126 View CSV PDB
YR363M 0.8372 -0.023 View CSV PDB
 
Laboratory of Theory of Biopolymers 2018