Project name: query_structure

Status: done

Started: 2026-03-16 20:40:09
Settings
Chain sequence(s) A: MAASSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAYEFYSGEYSHFSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:36)
Show buried residues

Minimal score value
-2.5444
Maximal score value
1.9301
Average score
-0.4473
Total score value
-42.9431

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.0672
2 A A 0.5058
3 A A 0.4075
4 S A 0.1934
5 S A 0.1246
6 V A 0.1358
7 P A 0.0000
8 T A -1.3789
9 K A -2.4499
10 L A -1.5087
11 E A -1.7693
12 V A 0.1680
13 V A 1.5528
14 A A 0.8806
15 A A 0.2961
16 T A -0.6048
17 P A -1.1802
18 T A -1.0293
19 S A -0.5633
20 L A 0.0000
21 L A 0.6900
22 I A 0.0000
23 S A -0.8033
24 W A 0.0000
25 D A -2.1975
26 A A -0.9505
27 P A -0.2017
28 A A 0.1743
29 V A 0.6361
30 T A 0.4857
31 V A 0.0423
32 D A -0.4553
33 H A -0.6648
34 Y A 0.0000
35 V A -0.1415
36 I A 0.0000
37 T A -0.6021
38 Y A 0.0000
39 G A 0.0000
40 E A -1.6131
41 T A -1.2377
42 G A -1.1810
43 G A -1.2881
44 N A -1.4924
45 S A -0.8508
46 P A -0.4083
47 V A 0.2415
48 Q A -1.2415
49 E A -1.7017
50 F A -0.6716
51 T A -0.1653
52 V A 0.0000
53 P A -1.0937
54 G A -1.2423
55 S A -1.3622
56 K A -2.0606
57 S A -1.3259
58 T A -0.6891
59 A A 0.0000
60 T A 0.2694
61 I A 0.0000
62 S A -0.6729
63 G A -1.0429
64 L A 0.0000
65 K A -2.3943
66 P A -1.6721
67 G A -1.4571
68 V A -1.5301
69 D A -2.0591
70 Y A 0.0000
71 T A -0.7352
72 I A 0.0000
73 T A -0.1401
74 V A 0.0000
75 Y A 0.1340
76 A A 0.0000
77 Y A 0.4365
78 E A 0.0000
79 F A 1.9301
80 Y A 1.6077
81 S A 0.2631
82 G A -0.3257
83 E A -0.6012
84 Y A 1.0358
85 S A 0.3042
86 H A -0.3184
87 F A 0.0795
88 S A -0.0949
89 P A 0.1141
90 I A 0.2965
91 S A -0.2277
92 I A -0.3976
93 N A -1.6901
94 Y A -1.4574
95 R A -2.5444
96 T A -1.5281
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018