Project name: IL15 [mutate: NK4A, VT3A]

Status: done

Started: 2026-04-13 07:58:04
Settings
Chain sequence(s) A: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues VT3A,NK4A
Energy difference between WT (input) and mutated protein (by FoldX) -1.35555 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:50)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:05)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:43)
Show buried residues

Minimal score value
-4.1609
Maximal score value
1.1304
Average score
-1.1121
Total score value
-126.7758

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 N A -1.7011
2 W A 0.0000
3 T A -1.1306 mutated: VT3A
4 K A -2.2195 mutated: NK4A
5 V A 0.0000
6 I A -1.1874
7 S A -1.6418
8 D A 0.0000
9 L A 0.0000
10 K A -3.2694
11 K A -2.9559
12 I A 0.0000
13 E A -3.4848
14 D A -3.3964
15 L A -1.8486
16 I A 0.0000
17 Q A -2.2332
18 S A -1.1681
19 M A -1.0632
20 H A -1.6665
21 I A -1.5677
22 D A -2.3247
23 A A -1.5306
24 T A -1.5362
25 L A 0.0000
26 Y A -1.7686
27 T A 0.0000
28 E A -1.9593
29 S A -1.8192
30 D A -2.2355
31 V A -1.4576
32 H A -1.5922
33 P A -1.0197
34 S A -0.6803
35 C A -0.7690
36 K A -0.6015
37 V A -0.2149
38 T A -0.8311
39 A A 0.0000
40 M A 0.0000
41 K A -0.7050
42 C A 0.0000
43 F A 0.0000
44 L A 0.0000
45 L A 1.1304
46 E A 0.0000
47 L A 0.0000
48 Q A 0.0146
49 V A 0.5839
50 I A 0.0000
51 S A 0.0000
52 L A 0.3849
53 E A -1.6093
54 S A -1.1406
55 G A -0.8865
56 D A -1.1138
57 A A -0.9181
58 S A -1.2060
59 I A 0.0000
60 H A -2.0539
61 D A -2.8922
62 T A 0.0000
63 V A 0.0000
64 E A -2.0170
65 N A -1.3311
66 L A 0.0000
67 I A 0.3598
68 I A 1.0251
69 L A -0.3442
70 A A 0.0000
71 N A -0.5217
72 N A -1.2895
73 S A -1.1598
74 L A 0.0000
75 S A -1.5248
76 S A -1.6137
77 N A -1.9361
78 G A -1.5891
79 N A -1.5063
80 V A -0.3469
81 T A -0.2642
82 E A -0.5300
83 S A -0.7322
84 G A -1.2090
85 C A -1.8027
86 K A -3.4170
87 E A -3.8138
88 C A -2.8732
89 E A -3.8293
90 E A -4.1609
91 L A -3.1958
92 E A -3.0462
93 E A -2.7353
94 K A -2.2013
95 N A -2.1670
96 I A -1.9237
97 K A -2.8151
98 E A -2.3420
99 F A 0.0000
100 L A 0.0000
101 Q A -1.8609
102 S A 0.0000
103 F A 0.0000
104 V A -0.6160
105 H A -1.3090
106 I A 0.0000
107 V A 0.0000
108 Q A -0.9669
109 M A -0.6855
110 F A 0.0000
111 I A -0.6221
112 N A -1.2370
113 T A -0.6975
114 S A -0.6407
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018