Project name: query_structure

Status: done

Started: 2026-03-16 20:38:54
Settings
Chain sequence(s) A: LQVDIVPSQGEISVGESKFFLCQVAGSGSDIRISWESPNGKKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVYRTGGYRHRALVLGEATVNVKIFQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:55)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:55)
Show buried residues

Minimal score value
-3.3921
Maximal score value
1.861
Average score
-0.8658
Total score value
-89.1769

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 0.5861
2 Q A -1.0163
3 V A -1.1556
4 D A -1.3375
5 I A 0.0000
6 V A 0.5671
7 P A -0.2031
8 S A -0.8582
9 Q A -2.0825
10 G A 0.0000
11 E A -2.9060
12 I A 0.0000
13 S A -1.1024
14 V A -0.1506
15 G A -1.2367
16 E A -2.1305
17 S A -0.9714
18 K A -0.4358
19 F A 1.8610
20 F A 0.0000
21 L A 0.7460
22 C A 0.0000
23 Q A -1.3557
24 V A 0.0000
25 A A -0.4888
26 G A -0.4190
27 S A -0.6983
28 G A -1.0829
29 S A -1.6755
30 D A -2.6040
31 I A -1.5161
32 R A -1.4971
33 I A 0.0000
34 S A -0.7461
35 W A 0.0000
36 E A -2.1115
37 S A -1.7316
38 P A -1.5047
39 N A -2.2051
40 G A -2.4153
41 K A -3.3909
42 K A -3.0886
43 L A 0.0000
44 T A -1.1911
45 P A -0.9998
46 N A -2.0046
47 Q A -2.1344
48 Q A -2.1599
49 R A -1.5584
50 I A 0.0000
51 S A -0.2584
52 V A 0.0000
53 V A 0.7213
54 W A -0.5827
55 N A -1.8647
56 D A -3.0112
57 D A -3.3921
58 S A -2.0443
59 S A -1.5783
60 S A 0.0000
61 T A 0.6672
62 L A 0.0000
63 T A 0.8606
64 I A 0.0000
65 Y A -0.6108
66 N A -1.9147
67 A A 0.0000
68 N A -1.1714
69 I A -0.1639
70 D A -1.6361
71 D A 0.0000
72 A A -1.0303
73 G A -0.6089
74 I A -0.0669
75 Y A 0.0000
76 K A -1.4189
77 C A 0.0000
78 V A -0.6277
79 V A 0.0000
80 Y A 0.1161
81 R A -1.0312
82 T A -1.4823
83 G A -1.6923
84 G A -1.2296
85 Y A -0.4068
86 R A -2.4971
87 H A -2.5451
88 R A -2.4758
89 A A -0.7394
90 L A 1.3068
91 V A 1.8590
92 L A 1.2226
93 G A -0.0674
94 E A -1.6153
95 A A -1.4951
96 T A -0.9524
97 V A 0.0000
98 N A -1.7760
99 V A 0.0000
100 K A -2.6022
101 I A 0.0000
102 F A -0.4647
103 Q A -0.4707
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018